Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F9XMI0

Protein Details
Accession F9XMI0    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MAKSKNSSQHNQSKKNHKNGIKKPKTNRYPSLKHydrophilic
NLS Segment(s)
PositionSequence
14-62KKNHKNGIKKPKTNRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKR
Subcellular Location(s) nucl 19, cyto_nucl 12.5, mito 4, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ztr:MYCGRDRAFT_82510  -  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNSSQHNQSKKNHKNGIKKPKTNRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.84
3 0.84
4 0.83
5 0.83
6 0.84
7 0.87
8 0.86
9 0.85
10 0.85
11 0.86
12 0.86
13 0.83
14 0.82
15 0.79
16 0.75
17 0.71
18 0.67
19 0.61
20 0.57
21 0.52
22 0.54
23 0.5
24 0.52
25 0.56
26 0.59
27 0.64
28 0.66
29 0.72
30 0.66
31 0.71
32 0.65
33 0.66
34 0.64
35 0.57
36 0.54
37 0.48
38 0.45
39 0.39
40 0.39
41 0.31
42 0.31
43 0.36
44 0.4
45 0.44