Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F9XEZ1

Protein Details
Accession F9XEZ1    Localization Confidence Low Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
129-150KFKNEADRRKYRGKNKIPMETFHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 12, mito 6, cyto 2, golg 2, vacu 2, nucl 1, pero 1, E.R. 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0016020  C:membrane  
KEGG ztr:MYCGRDRAFT_100674  -  
Pfam View protein in Pfam  
PF02353  CMAS  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MSDANKNPGASLAEDDFEFIETPAAPTPVSGESDCGVRTTSYKAIKNAPLPADGPASDNFSNTLLFTLLAVIPGYIAYQLGGRFWTWLFFLILTAIPILMAFWTIASGMSPRLNEKARYPGRPIEHYLKFKNEADRRKYRGKNKIPMETFHEMYFAGDVDFKGDCLEVMEYRHDWANFRFTLSLFWFFLTGMMPEVIMHTRSQDEEQVRDHYDRGDDFYGWFLGPRMIYTSGVISDINQEESLEQLQDNKLSIVCEKIGLQKGERMLDIGCGWGTLAKFASVNYGAHATGVTLGRNQTAWGNSGLRKAGITEEQSKILCMDYRDIPVPEGGWNKITCLEMAEHVGVRYFGTFLKQVHDMLDDDGVFFLQIAGLRKSWQYEDLIWGLFMNKYIFPGADASTPLGFFVDKLEGAGFEVKAVDTIGVHYSATLWRWYRNWMANKEKVVAKYGDRWFRIWEFFLAYSTIISRQGSATCYQITLVKNINSTHRIEGIHNAHGLSGALKASKEAGKHAFPGSKKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.17
4 0.16
5 0.15
6 0.11
7 0.1
8 0.09
9 0.11
10 0.12
11 0.13
12 0.12
13 0.11
14 0.14
15 0.15
16 0.18
17 0.16
18 0.16
19 0.16
20 0.19
21 0.19
22 0.17
23 0.15
24 0.13
25 0.14
26 0.17
27 0.24
28 0.3
29 0.35
30 0.39
31 0.45
32 0.51
33 0.54
34 0.56
35 0.51
36 0.46
37 0.42
38 0.4
39 0.36
40 0.29
41 0.27
42 0.21
43 0.24
44 0.22
45 0.21
46 0.2
47 0.18
48 0.18
49 0.15
50 0.15
51 0.09
52 0.09
53 0.08
54 0.1
55 0.09
56 0.09
57 0.09
58 0.07
59 0.07
60 0.07
61 0.07
62 0.05
63 0.05
64 0.04
65 0.06
66 0.07
67 0.08
68 0.09
69 0.09
70 0.1
71 0.1
72 0.11
73 0.1
74 0.12
75 0.12
76 0.11
77 0.11
78 0.11
79 0.11
80 0.1
81 0.09
82 0.07
83 0.06
84 0.06
85 0.05
86 0.04
87 0.04
88 0.04
89 0.03
90 0.04
91 0.04
92 0.04
93 0.05
94 0.06
95 0.08
96 0.1
97 0.11
98 0.13
99 0.19
100 0.22
101 0.24
102 0.26
103 0.35
104 0.39
105 0.43
106 0.46
107 0.48
108 0.49
109 0.52
110 0.54
111 0.52
112 0.54
113 0.56
114 0.55
115 0.54
116 0.53
117 0.52
118 0.56
119 0.55
120 0.57
121 0.59
122 0.64
123 0.65
124 0.71
125 0.76
126 0.76
127 0.79
128 0.8
129 0.8
130 0.79
131 0.82
132 0.75
133 0.69
134 0.67
135 0.6
136 0.52
137 0.42
138 0.35
139 0.25
140 0.22
141 0.19
142 0.12
143 0.07
144 0.07
145 0.07
146 0.08
147 0.08
148 0.07
149 0.07
150 0.07
151 0.06
152 0.07
153 0.08
154 0.07
155 0.09
156 0.11
157 0.11
158 0.13
159 0.16
160 0.15
161 0.16
162 0.16
163 0.21
164 0.19
165 0.2
166 0.2
167 0.17
168 0.2
169 0.21
170 0.22
171 0.17
172 0.17
173 0.16
174 0.14
175 0.15
176 0.12
177 0.09
178 0.07
179 0.06
180 0.06
181 0.06
182 0.07
183 0.07
184 0.08
185 0.07
186 0.07
187 0.08
188 0.1
189 0.11
190 0.15
191 0.16
192 0.17
193 0.19
194 0.22
195 0.23
196 0.23
197 0.22
198 0.18
199 0.18
200 0.16
201 0.18
202 0.16
203 0.13
204 0.13
205 0.13
206 0.13
207 0.11
208 0.11
209 0.08
210 0.07
211 0.07
212 0.07
213 0.09
214 0.09
215 0.09
216 0.1
217 0.1
218 0.09
219 0.1
220 0.09
221 0.07
222 0.09
223 0.09
224 0.09
225 0.08
226 0.08
227 0.07
228 0.08
229 0.09
230 0.06
231 0.06
232 0.07
233 0.07
234 0.08
235 0.08
236 0.08
237 0.08
238 0.08
239 0.08
240 0.08
241 0.07
242 0.07
243 0.08
244 0.13
245 0.16
246 0.16
247 0.16
248 0.17
249 0.19
250 0.19
251 0.18
252 0.14
253 0.11
254 0.11
255 0.1
256 0.08
257 0.06
258 0.05
259 0.05
260 0.06
261 0.06
262 0.06
263 0.06
264 0.06
265 0.06
266 0.06
267 0.09
268 0.08
269 0.09
270 0.08
271 0.1
272 0.09
273 0.09
274 0.09
275 0.06
276 0.08
277 0.08
278 0.08
279 0.08
280 0.08
281 0.09
282 0.09
283 0.09
284 0.09
285 0.09
286 0.1
287 0.11
288 0.14
289 0.15
290 0.17
291 0.17
292 0.15
293 0.14
294 0.13
295 0.13
296 0.13
297 0.15
298 0.18
299 0.19
300 0.21
301 0.21
302 0.2
303 0.19
304 0.17
305 0.15
306 0.11
307 0.13
308 0.13
309 0.15
310 0.17
311 0.17
312 0.17
313 0.16
314 0.15
315 0.16
316 0.16
317 0.15
318 0.15
319 0.15
320 0.15
321 0.17
322 0.17
323 0.13
324 0.12
325 0.12
326 0.1
327 0.12
328 0.12
329 0.1
330 0.1
331 0.1
332 0.09
333 0.08
334 0.08
335 0.06
336 0.06
337 0.08
338 0.11
339 0.11
340 0.13
341 0.15
342 0.15
343 0.15
344 0.17
345 0.15
346 0.14
347 0.15
348 0.12
349 0.1
350 0.1
351 0.09
352 0.07
353 0.06
354 0.05
355 0.04
356 0.06
357 0.09
358 0.11
359 0.11
360 0.13
361 0.14
362 0.16
363 0.17
364 0.17
365 0.17
366 0.16
367 0.2
368 0.2
369 0.2
370 0.18
371 0.16
372 0.15
373 0.12
374 0.13
375 0.11
376 0.09
377 0.1
378 0.11
379 0.1
380 0.1
381 0.12
382 0.12
383 0.12
384 0.12
385 0.13
386 0.13
387 0.13
388 0.12
389 0.1
390 0.09
391 0.07
392 0.09
393 0.09
394 0.08
395 0.09
396 0.09
397 0.09
398 0.11
399 0.13
400 0.1
401 0.09
402 0.09
403 0.09
404 0.09
405 0.09
406 0.07
407 0.05
408 0.07
409 0.08
410 0.08
411 0.08
412 0.08
413 0.09
414 0.11
415 0.12
416 0.16
417 0.16
418 0.19
419 0.21
420 0.26
421 0.32
422 0.39
423 0.46
424 0.5
425 0.57
426 0.6
427 0.62
428 0.63
429 0.6
430 0.53
431 0.49
432 0.43
433 0.38
434 0.4
435 0.45
436 0.48
437 0.46
438 0.46
439 0.46
440 0.47
441 0.48
442 0.41
443 0.35
444 0.3
445 0.29
446 0.29
447 0.24
448 0.2
449 0.17
450 0.16
451 0.16
452 0.14
453 0.14
454 0.14
455 0.14
456 0.16
457 0.18
458 0.18
459 0.2
460 0.18
461 0.18
462 0.18
463 0.21
464 0.21
465 0.23
466 0.27
467 0.27
468 0.3
469 0.32
470 0.38
471 0.37
472 0.39
473 0.38
474 0.36
475 0.35
476 0.33
477 0.4
478 0.38
479 0.38
480 0.36
481 0.32
482 0.28
483 0.27
484 0.25
485 0.16
486 0.13
487 0.11
488 0.11
489 0.11
490 0.12
491 0.16
492 0.18
493 0.19
494 0.24
495 0.28
496 0.3
497 0.34
498 0.39
499 0.42