Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F9XJQ1

Protein Details
Accession F9XJQ1    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
8-31EPSPQARIRDNQRRSRARRKEYLQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
KEGG ztr:MYCGRDRAFT_47526  -  
Amino Acid Sequences MVSTTPSEPSPQARIRDNQRRSRARRKEYLQELETKYRTCEQIGASASTEIQAAARKVADENRRLRVLLQSHGIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.53
3 0.61
4 0.66
5 0.68
6 0.72
7 0.78
8 0.82
9 0.85
10 0.85
11 0.83
12 0.83
13 0.79
14 0.79
15 0.77
16 0.76
17 0.67
18 0.64
19 0.59
20 0.55
21 0.51
22 0.41
23 0.34
24 0.29
25 0.28
26 0.21
27 0.19
28 0.15
29 0.19
30 0.2
31 0.19
32 0.18
33 0.17
34 0.16
35 0.14
36 0.13
37 0.07
38 0.07
39 0.08
40 0.08
41 0.09
42 0.09
43 0.1
44 0.12
45 0.19
46 0.25
47 0.31
48 0.36
49 0.41
50 0.43
51 0.43
52 0.42
53 0.43
54 0.4
55 0.37