Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F9XR31

Protein Details
Accession F9XR31   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
33-55ALEKTKDEKTKDKKNQGRAVCTQHydrophilic
NLS Segment(s)
PositionSequence
127-141GRRFRLRPGRLRRRR
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 4
Family & Domain DBs
KEGG ztr:MYCGRDRAFT_97638  -  
Amino Acid Sequences MSGLREVSRKTTFEPAEHLRQNSLSTLAMKLRALEKTKDEKTKDKKNQGRAVCTQTFNIETPAPKSNTRTTKAVVCLRRHLIYREMKRAELSMLRHAISNKQASQRGKGSEQVGKQVAHRYDTLRVGRRFRLRPGRLRRRRYIIALAPFRLSSHALSSSRFKDQHAKCQVPKSGYAGINAEIDNDFYDYEFYHCQDDLKYGDDAYWGETDSLSSLYFLSSLYFRSRSESSGREVMADWQSKWLDYDSDFVLNKTFPKPPKGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.44
3 0.49
4 0.52
5 0.5
6 0.43
7 0.42
8 0.42
9 0.35
10 0.31
11 0.23
12 0.19
13 0.2
14 0.2
15 0.21
16 0.2
17 0.21
18 0.23
19 0.27
20 0.3
21 0.3
22 0.36
23 0.42
24 0.5
25 0.56
26 0.57
27 0.61
28 0.67
29 0.74
30 0.77
31 0.79
32 0.79
33 0.81
34 0.85
35 0.82
36 0.8
37 0.75
38 0.73
39 0.67
40 0.61
41 0.51
42 0.45
43 0.41
44 0.34
45 0.3
46 0.24
47 0.2
48 0.22
49 0.27
50 0.27
51 0.27
52 0.3
53 0.36
54 0.42
55 0.45
56 0.45
57 0.41
58 0.44
59 0.48
60 0.52
61 0.51
62 0.46
63 0.48
64 0.49
65 0.5
66 0.46
67 0.42
68 0.42
69 0.44
70 0.48
71 0.51
72 0.49
73 0.46
74 0.45
75 0.43
76 0.37
77 0.32
78 0.27
79 0.24
80 0.24
81 0.23
82 0.24
83 0.24
84 0.25
85 0.26
86 0.27
87 0.25
88 0.28
89 0.33
90 0.33
91 0.37
92 0.38
93 0.37
94 0.34
95 0.35
96 0.33
97 0.32
98 0.31
99 0.31
100 0.3
101 0.27
102 0.27
103 0.29
104 0.26
105 0.23
106 0.24
107 0.21
108 0.21
109 0.26
110 0.29
111 0.31
112 0.34
113 0.35
114 0.4
115 0.46
116 0.45
117 0.47
118 0.53
119 0.51
120 0.57
121 0.65
122 0.71
123 0.73
124 0.78
125 0.77
126 0.74
127 0.72
128 0.66
129 0.61
130 0.56
131 0.54
132 0.49
133 0.44
134 0.37
135 0.34
136 0.3
137 0.24
138 0.2
139 0.12
140 0.11
141 0.15
142 0.14
143 0.16
144 0.2
145 0.22
146 0.26
147 0.26
148 0.26
149 0.31
150 0.33
151 0.42
152 0.47
153 0.5
154 0.48
155 0.55
156 0.57
157 0.49
158 0.48
159 0.42
160 0.4
161 0.35
162 0.33
163 0.27
164 0.24
165 0.24
166 0.22
167 0.19
168 0.11
169 0.11
170 0.1
171 0.09
172 0.07
173 0.06
174 0.07
175 0.06
176 0.09
177 0.1
178 0.1
179 0.12
180 0.12
181 0.13
182 0.13
183 0.15
184 0.14
185 0.15
186 0.15
187 0.13
188 0.13
189 0.13
190 0.13
191 0.12
192 0.11
193 0.09
194 0.09
195 0.09
196 0.09
197 0.09
198 0.09
199 0.07
200 0.07
201 0.07
202 0.06
203 0.07
204 0.07
205 0.07
206 0.07
207 0.09
208 0.13
209 0.15
210 0.16
211 0.21
212 0.22
213 0.24
214 0.29
215 0.3
216 0.31
217 0.34
218 0.34
219 0.3
220 0.29
221 0.32
222 0.33
223 0.33
224 0.28
225 0.29
226 0.29
227 0.29
228 0.29
229 0.25
230 0.21
231 0.19
232 0.22
233 0.18
234 0.23
235 0.24
236 0.22
237 0.23
238 0.22
239 0.24
240 0.25
241 0.3
242 0.3