Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F9XF88

Protein Details
Accession F9XF88   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
204-227LLPRYCFCHCRKRREVRRGGEENEHydrophilic
NLS Segment(s)
PositionSequence
294-297KPER
Subcellular Location(s) mito 26
Family & Domain DBs
KEGG ztr:MYCGRDRAFT_94815  -  
Amino Acid Sequences MRLRLQPHHLTPSAPLRLGLHTQLTNSGSHCVGHAISLRPVVLRNNGEMRPYPLEPHLDALVLKLWNLGANVLYQFDVAAVSCGHVGTLDVRDGEFTVGDDYDRVDPVSEAHCEFQRRVNGEHLRLEGQLILCAEALSGGGRYAEPSAVDPGAAGRAAEESAVVETELCAAVDEELTGSAGLLLLLLLLQRHLGGRRRGEKGMLLPRYCFCHCRKRREVRRGGEENERNCFCFREVVDAAGKEIVALAFAVFGGRDFEGEERSRGQIASASEGILMLLPRTVISSSEPEHKREKPERR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.37
3 0.31
4 0.33
5 0.35
6 0.33
7 0.29
8 0.25
9 0.25
10 0.28
11 0.28
12 0.25
13 0.23
14 0.23
15 0.18
16 0.18
17 0.17
18 0.14
19 0.13
20 0.14
21 0.17
22 0.17
23 0.19
24 0.2
25 0.2
26 0.19
27 0.21
28 0.22
29 0.25
30 0.24
31 0.26
32 0.31
33 0.32
34 0.34
35 0.34
36 0.35
37 0.34
38 0.33
39 0.31
40 0.27
41 0.3
42 0.28
43 0.29
44 0.24
45 0.2
46 0.19
47 0.17
48 0.18
49 0.14
50 0.13
51 0.11
52 0.1
53 0.11
54 0.11
55 0.1
56 0.07
57 0.08
58 0.09
59 0.09
60 0.09
61 0.07
62 0.07
63 0.06
64 0.06
65 0.05
66 0.06
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.05
73 0.05
74 0.06
75 0.07
76 0.08
77 0.08
78 0.08
79 0.08
80 0.09
81 0.09
82 0.07
83 0.06
84 0.06
85 0.06
86 0.06
87 0.06
88 0.07
89 0.08
90 0.08
91 0.08
92 0.07
93 0.07
94 0.09
95 0.1
96 0.11
97 0.1
98 0.12
99 0.14
100 0.16
101 0.17
102 0.21
103 0.24
104 0.25
105 0.26
106 0.33
107 0.35
108 0.36
109 0.38
110 0.34
111 0.3
112 0.28
113 0.26
114 0.19
115 0.14
116 0.12
117 0.1
118 0.09
119 0.07
120 0.07
121 0.06
122 0.05
123 0.05
124 0.03
125 0.03
126 0.03
127 0.03
128 0.03
129 0.04
130 0.04
131 0.05
132 0.05
133 0.05
134 0.07
135 0.06
136 0.06
137 0.06
138 0.05
139 0.06
140 0.05
141 0.04
142 0.03
143 0.04
144 0.04
145 0.04
146 0.04
147 0.03
148 0.04
149 0.04
150 0.04
151 0.03
152 0.03
153 0.04
154 0.04
155 0.03
156 0.04
157 0.04
158 0.04
159 0.04
160 0.04
161 0.03
162 0.03
163 0.04
164 0.03
165 0.03
166 0.03
167 0.03
168 0.03
169 0.02
170 0.02
171 0.02
172 0.02
173 0.02
174 0.02
175 0.03
176 0.03
177 0.03
178 0.05
179 0.09
180 0.15
181 0.21
182 0.28
183 0.35
184 0.39
185 0.4
186 0.4
187 0.39
188 0.41
189 0.44
190 0.43
191 0.38
192 0.36
193 0.36
194 0.41
195 0.39
196 0.37
197 0.33
198 0.38
199 0.45
200 0.54
201 0.63
202 0.68
203 0.78
204 0.84
205 0.88
206 0.86
207 0.88
208 0.85
209 0.78
210 0.77
211 0.74
212 0.66
213 0.63
214 0.55
215 0.47
216 0.41
217 0.38
218 0.29
219 0.27
220 0.24
221 0.25
222 0.25
223 0.26
224 0.28
225 0.27
226 0.26
227 0.22
228 0.21
229 0.12
230 0.12
231 0.09
232 0.06
233 0.05
234 0.04
235 0.04
236 0.04
237 0.04
238 0.04
239 0.04
240 0.06
241 0.06
242 0.06
243 0.07
244 0.09
245 0.14
246 0.16
247 0.18
248 0.18
249 0.2
250 0.21
251 0.2
252 0.19
253 0.18
254 0.18
255 0.22
256 0.2
257 0.18
258 0.17
259 0.17
260 0.16
261 0.13
262 0.12
263 0.06
264 0.06
265 0.06
266 0.06
267 0.08
268 0.08
269 0.08
270 0.12
271 0.17
272 0.19
273 0.29
274 0.32
275 0.35
276 0.42
277 0.46
278 0.53