Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F9X4K4

Protein Details
Accession F9X4K4   
Localization Confidence Low
Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
32-53TDEWHKIRKDNHKEVERRRRETBasic
NLS Segment(s)
Subcellular Location(s) nucl 7mito 7mito_nucl 7, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR011598  bHLH_dom  
IPR047206  bHLHzip_scCBP1-like  
IPR036638  HLH_DNA-bd_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0046983  F:protein dimerization activity  
KEGG ztr:MYCGRDRAFT_37366  -  
Pfam View protein in Pfam  
PF00010  HLH  
PROSITE View protein in PROSITE  
PS50888  BHLH  
CDD cd11398  bHLHzip_scCBP1  
Amino Acid Sequences MGGGPGVSNGEGSPTDGGPQAPGSSSKPQVGTDEWHKIRKDNHKEVERRRRETINEGINELAKIVPGCEKNKGSILARAVQFITQLKENETQNIEKWTLEKLLSEQAITELGTSCDKLKAECQRAWAECEQWKKAAQKAGVTIDHDEKGEGDAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.13
4 0.13
5 0.12
6 0.13
7 0.12
8 0.11
9 0.13
10 0.16
11 0.21
12 0.24
13 0.26
14 0.27
15 0.27
16 0.29
17 0.29
18 0.3
19 0.31
20 0.38
21 0.38
22 0.42
23 0.42
24 0.43
25 0.49
26 0.55
27 0.58
28 0.58
29 0.64
30 0.67
31 0.75
32 0.82
33 0.85
34 0.83
35 0.79
36 0.74
37 0.69
38 0.63
39 0.61
40 0.58
41 0.54
42 0.46
43 0.41
44 0.37
45 0.32
46 0.28
47 0.22
48 0.14
49 0.07
50 0.06
51 0.06
52 0.09
53 0.12
54 0.14
55 0.18
56 0.19
57 0.2
58 0.22
59 0.24
60 0.21
61 0.21
62 0.22
63 0.21
64 0.21
65 0.2
66 0.18
67 0.16
68 0.16
69 0.14
70 0.13
71 0.11
72 0.11
73 0.13
74 0.17
75 0.17
76 0.19
77 0.21
78 0.21
79 0.19
80 0.22
81 0.2
82 0.16
83 0.17
84 0.16
85 0.15
86 0.14
87 0.13
88 0.11
89 0.15
90 0.15
91 0.15
92 0.13
93 0.12
94 0.12
95 0.11
96 0.1
97 0.06
98 0.07
99 0.08
100 0.09
101 0.09
102 0.11
103 0.12
104 0.12
105 0.19
106 0.28
107 0.34
108 0.35
109 0.39
110 0.43
111 0.45
112 0.49
113 0.44
114 0.4
115 0.39
116 0.44
117 0.41
118 0.37
119 0.41
120 0.4
121 0.43
122 0.45
123 0.43
124 0.4
125 0.43
126 0.47
127 0.44
128 0.43
129 0.42
130 0.38
131 0.36
132 0.32
133 0.27
134 0.21