Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F9XQ17

Protein Details
Accession F9XQ17   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
346-373AFLLRMLRLRKPRPSTRRIKAERPSAATHydrophilic
NLS Segment(s)
PositionSequence
354-366LRKPRPSTRRIKA
Subcellular Location(s) plas 14, mito 7, E.R. 4, cyto_mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR026841  Aur1/Ipt1  
Gene Ontology GO:0016020  C:membrane  
KEGG ztr:MYCGRDRAFT_50949  -  
Pfam View protein in Pfam  
PF14378  PAP2_3  
CDD cd03386  PAP2_Aur1_like  
Amino Acid Sequences QLVVTIMVTSLIVNRDRKFSLFSNRNEPVNEALMKSEDIDDSSRGSSRSASPNGPKNSLDLQRSISGSGIEVSRMNFPSRILQKFPFLVEMFYWALNFIAYSMTKKIGAALYSRYGGDAVTQLAQDHGIAILNFEHNSPASIFFPVSEVEFQQFLLTKHLSIMTIFNQIYSLVHIPGTVAYLSWYYYKAPSYDAFAVARRTMTLGNFSAFFIFSFYPCMPPRLLPESFGFKDTVRQEHAESVWVGGSNVNQLAAMPSLHFTYAFTIGCTFLYTSGLLQSWRGRRSGRSPFFSFVYVVAGILYPLLVLSVIVATANHYYLDAVVATFSVAMSFLCNRIWLFLLPVEAFLLRMLRLRKPRPSTRRIKAERPSAATSSSLEVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.29
3 0.31
4 0.33
5 0.35
6 0.38
7 0.43
8 0.47
9 0.5
10 0.55
11 0.57
12 0.59
13 0.55
14 0.51
15 0.44
16 0.41
17 0.37
18 0.28
19 0.25
20 0.24
21 0.23
22 0.21
23 0.19
24 0.14
25 0.14
26 0.16
27 0.15
28 0.16
29 0.17
30 0.18
31 0.17
32 0.17
33 0.18
34 0.22
35 0.29
36 0.31
37 0.37
38 0.43
39 0.51
40 0.56
41 0.57
42 0.51
43 0.47
44 0.5
45 0.5
46 0.45
47 0.38
48 0.37
49 0.37
50 0.37
51 0.34
52 0.27
53 0.2
54 0.18
55 0.17
56 0.13
57 0.11
58 0.11
59 0.12
60 0.16
61 0.17
62 0.19
63 0.18
64 0.18
65 0.26
66 0.32
67 0.35
68 0.35
69 0.35
70 0.38
71 0.39
72 0.39
73 0.35
74 0.28
75 0.25
76 0.21
77 0.22
78 0.19
79 0.17
80 0.16
81 0.11
82 0.11
83 0.09
84 0.09
85 0.05
86 0.06
87 0.07
88 0.09
89 0.11
90 0.12
91 0.12
92 0.12
93 0.14
94 0.14
95 0.15
96 0.15
97 0.16
98 0.17
99 0.18
100 0.18
101 0.16
102 0.14
103 0.13
104 0.11
105 0.09
106 0.08
107 0.08
108 0.08
109 0.08
110 0.08
111 0.08
112 0.07
113 0.06
114 0.05
115 0.05
116 0.05
117 0.05
118 0.06
119 0.07
120 0.07
121 0.07
122 0.08
123 0.07
124 0.08
125 0.08
126 0.09
127 0.09
128 0.1
129 0.1
130 0.09
131 0.1
132 0.09
133 0.1
134 0.08
135 0.08
136 0.09
137 0.09
138 0.09
139 0.08
140 0.1
141 0.1
142 0.13
143 0.13
144 0.12
145 0.12
146 0.13
147 0.12
148 0.11
149 0.12
150 0.1
151 0.14
152 0.14
153 0.13
154 0.13
155 0.13
156 0.12
157 0.12
158 0.12
159 0.07
160 0.07
161 0.07
162 0.07
163 0.07
164 0.08
165 0.05
166 0.04
167 0.05
168 0.05
169 0.06
170 0.06
171 0.07
172 0.07
173 0.08
174 0.09
175 0.09
176 0.11
177 0.1
178 0.14
179 0.14
180 0.15
181 0.14
182 0.15
183 0.16
184 0.14
185 0.14
186 0.1
187 0.1
188 0.1
189 0.09
190 0.11
191 0.1
192 0.1
193 0.11
194 0.11
195 0.1
196 0.1
197 0.09
198 0.08
199 0.08
200 0.07
201 0.1
202 0.1
203 0.14
204 0.15
205 0.17
206 0.16
207 0.16
208 0.21
209 0.23
210 0.23
211 0.21
212 0.23
213 0.28
214 0.28
215 0.28
216 0.25
217 0.19
218 0.25
219 0.25
220 0.26
221 0.22
222 0.23
223 0.23
224 0.25
225 0.25
226 0.21
227 0.18
228 0.15
229 0.13
230 0.12
231 0.11
232 0.08
233 0.08
234 0.07
235 0.07
236 0.07
237 0.06
238 0.06
239 0.07
240 0.07
241 0.07
242 0.05
243 0.06
244 0.07
245 0.07
246 0.07
247 0.07
248 0.08
249 0.11
250 0.11
251 0.11
252 0.11
253 0.11
254 0.11
255 0.12
256 0.1
257 0.07
258 0.08
259 0.08
260 0.08
261 0.09
262 0.1
263 0.09
264 0.11
265 0.17
266 0.22
267 0.24
268 0.27
269 0.27
270 0.32
271 0.4
272 0.49
273 0.51
274 0.52
275 0.54
276 0.54
277 0.53
278 0.5
279 0.42
280 0.31
281 0.26
282 0.19
283 0.15
284 0.12
285 0.1
286 0.08
287 0.07
288 0.06
289 0.03
290 0.03
291 0.03
292 0.03
293 0.02
294 0.03
295 0.03
296 0.03
297 0.03
298 0.03
299 0.05
300 0.06
301 0.07
302 0.07
303 0.07
304 0.07
305 0.07
306 0.08
307 0.07
308 0.06
309 0.05
310 0.05
311 0.05
312 0.05
313 0.05
314 0.04
315 0.04
316 0.04
317 0.06
318 0.08
319 0.09
320 0.09
321 0.11
322 0.11
323 0.13
324 0.15
325 0.13
326 0.15
327 0.15
328 0.18
329 0.17
330 0.17
331 0.16
332 0.14
333 0.14
334 0.12
335 0.12
336 0.09
337 0.14
338 0.17
339 0.24
340 0.34
341 0.42
342 0.51
343 0.59
344 0.7
345 0.75
346 0.82
347 0.85
348 0.85
349 0.89
350 0.87
351 0.88
352 0.86
353 0.86
354 0.84
355 0.8
356 0.75
357 0.66
358 0.6
359 0.51
360 0.44