Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F9XAN4

Protein Details
Accession F9XAN4   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MGSSMKKKKEKAKDFQKPKLKVGKARPKNTNAHydrophilic
NLS Segment(s)
PositionSequence
6-28KKKKEKAKDFQKPKLKVGKARPK
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
Gene Ontology GO:0005634  C:nucleus  
GO:0097344  C:Rix1 complex  
GO:0006364  P:rRNA processing  
KEGG ztr:MYCGRDRAFT_104345  -  
Amino Acid Sequences MGSSMKKKKEKAKDFQKPKLKVGKARPKNTNATDTSFAAKSIVLKQQSLTESGRDATALFNHNLSLLNSKNDAQRKDVLTYLTNTVAASPNSHPQPASVILSKAQPLILDGSAAIRSQVLKLFKVLPKNQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.91
3 0.91
4 0.85
5 0.83
6 0.83
7 0.78
8 0.76
9 0.77
10 0.78
11 0.78
12 0.81
13 0.81
14 0.77
15 0.79
16 0.74
17 0.7
18 0.62
19 0.57
20 0.51
21 0.44
22 0.41
23 0.32
24 0.28
25 0.21
26 0.18
27 0.15
28 0.16
29 0.2
30 0.18
31 0.18
32 0.18
33 0.22
34 0.23
35 0.24
36 0.21
37 0.16
38 0.16
39 0.16
40 0.15
41 0.11
42 0.1
43 0.08
44 0.09
45 0.1
46 0.1
47 0.09
48 0.09
49 0.1
50 0.1
51 0.1
52 0.11
53 0.09
54 0.1
55 0.11
56 0.13
57 0.17
58 0.21
59 0.22
60 0.22
61 0.26
62 0.27
63 0.28
64 0.28
65 0.25
66 0.22
67 0.22
68 0.21
69 0.17
70 0.15
71 0.13
72 0.13
73 0.13
74 0.12
75 0.13
76 0.13
77 0.19
78 0.2
79 0.21
80 0.19
81 0.17
82 0.21
83 0.2
84 0.22
85 0.18
86 0.18
87 0.18
88 0.2
89 0.21
90 0.18
91 0.15
92 0.12
93 0.11
94 0.13
95 0.12
96 0.1
97 0.09
98 0.1
99 0.11
100 0.11
101 0.1
102 0.08
103 0.08
104 0.1
105 0.15
106 0.17
107 0.17
108 0.2
109 0.27
110 0.31