Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F9XS53

Protein Details
Accession F9XS53   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
105-128SCRCGEVKDGGRRRRGRKEQRVARBasic
NLS Segment(s)
PositionSequence
114-128GGRRRRGRKEQRVAR
Subcellular Location(s) cyto 17.5, cyto_nucl 10, mito 5, cysk 2
Family & Domain DBs
KEGG ztr:MYCGRDRAFT_98043  -  
Amino Acid Sequences MPRDCIPTFALANSRVREQADEVEEIQLRPGRTVNSSIACIGRVRELFHGAVDVGIRFEYVFDPGSETADFVPAKDIVNASEWQAAVVFYEFVVLVDEILEKVLSCRCGEVKDGGRRRRGRKEQRVAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.29
4 0.28
5 0.26
6 0.28
7 0.26
8 0.26
9 0.24
10 0.25
11 0.25
12 0.23
13 0.23
14 0.2
15 0.18
16 0.16
17 0.17
18 0.16
19 0.17
20 0.2
21 0.21
22 0.2
23 0.21
24 0.21
25 0.2
26 0.19
27 0.18
28 0.15
29 0.15
30 0.14
31 0.15
32 0.15
33 0.17
34 0.16
35 0.16
36 0.16
37 0.11
38 0.11
39 0.09
40 0.07
41 0.05
42 0.05
43 0.05
44 0.04
45 0.04
46 0.04
47 0.05
48 0.06
49 0.06
50 0.08
51 0.08
52 0.09
53 0.09
54 0.09
55 0.08
56 0.1
57 0.1
58 0.08
59 0.1
60 0.09
61 0.1
62 0.1
63 0.1
64 0.08
65 0.1
66 0.11
67 0.1
68 0.12
69 0.11
70 0.11
71 0.11
72 0.1
73 0.08
74 0.08
75 0.07
76 0.04
77 0.05
78 0.05
79 0.05
80 0.06
81 0.06
82 0.05
83 0.05
84 0.06
85 0.05
86 0.06
87 0.06
88 0.04
89 0.06
90 0.09
91 0.1
92 0.1
93 0.13
94 0.14
95 0.16
96 0.19
97 0.25
98 0.32
99 0.41
100 0.5
101 0.55
102 0.63
103 0.7
104 0.77
105 0.8
106 0.83
107 0.84
108 0.85