Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q0V1T4

Protein Details
Accession Q0V1T4    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPAATGGKKQKKKWSKGKVKDKANHAVVHydrophilic
NLS Segment(s)
PositionSequence
8-23GKKQKKKWSKGKVKDK
Subcellular Location(s) cyto 9, nucl 8.5, mito_nucl 8, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0022627  C:cytosolic small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
KEGG pno:SNOG_02030  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAATGGKKQKKKWSKGKVKDKANHAVVLDKQTNDKLQKDVQSYRLITVATLVDRLKINGSLARKALADLEENGQIKKVVGHSKLSIYTRAVGATE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.86
4 0.89
5 0.93
6 0.92
7 0.92
8 0.88
9 0.85
10 0.83
11 0.74
12 0.66
13 0.55
14 0.5
15 0.41
16 0.4
17 0.35
18 0.26
19 0.25
20 0.24
21 0.28
22 0.27
23 0.27
24 0.23
25 0.25
26 0.29
27 0.32
28 0.33
29 0.32
30 0.34
31 0.33
32 0.3
33 0.28
34 0.23
35 0.18
36 0.16
37 0.13
38 0.08
39 0.09
40 0.08
41 0.09
42 0.09
43 0.1
44 0.09
45 0.09
46 0.1
47 0.12
48 0.15
49 0.16
50 0.16
51 0.17
52 0.16
53 0.16
54 0.16
55 0.14
56 0.13
57 0.12
58 0.14
59 0.18
60 0.18
61 0.18
62 0.17
63 0.16
64 0.15
65 0.15
66 0.19
67 0.21
68 0.23
69 0.28
70 0.29
71 0.33
72 0.39
73 0.39
74 0.37
75 0.32
76 0.31
77 0.28