Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F9X3K9

Protein Details
Accession F9X3K9    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPAATGGKKQKKKWSKGKVKDKAQHNVLHydrophilic
NLS Segment(s)
PositionSequence
8-23GKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 12, cyto_nucl 10.333, mito_nucl 8.833, cyto 7.5, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG ztr:MYCGRDRAFT_103162  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAATGGKKQKKKWSKGKVKDKAQHNVLLDKATNDKLQKDVQSYRLVTVAVLVDRLKINGSLARKCLADLEEKGVIKQVVNHHACKIYTRAVGGAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.86
4 0.89
5 0.93
6 0.92
7 0.92
8 0.9
9 0.87
10 0.85
11 0.78
12 0.73
13 0.64
14 0.57
15 0.47
16 0.41
17 0.33
18 0.25
19 0.24
20 0.2
21 0.21
22 0.18
23 0.18
24 0.19
25 0.22
26 0.23
27 0.25
28 0.26
29 0.26
30 0.3
31 0.29
32 0.27
33 0.25
34 0.22
35 0.17
36 0.15
37 0.12
38 0.07
39 0.07
40 0.06
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.08
47 0.1
48 0.14
49 0.16
50 0.17
51 0.19
52 0.18
53 0.18
54 0.2
55 0.17
56 0.19
57 0.18
58 0.21
59 0.24
60 0.24
61 0.24
62 0.25
63 0.24
64 0.19
65 0.22
66 0.24
67 0.29
68 0.33
69 0.35
70 0.35
71 0.39
72 0.39
73 0.37
74 0.35
75 0.31
76 0.3
77 0.29