Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F9X1X0

Protein Details
Accession F9X1X0   
Localization Confidence High
Confidence Score 17.9
NoLS Segment(s)
PositionSequenceProtein Nature
18-43YAHMLEKRRRDPRHNPPRRRPPLSTTBasic
70-98LPHSLPRQNQHIRRPQRQQQRHTNKSTAAHydrophilic
NLS Segment(s)
PositionSequence
24-38KRRRDPRHNPPRRRP
Subcellular Location(s) nucl 23, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
KEGG ztr:MYCGRDRAFT_103004  -  
Amino Acid Sequences MLSCFPTRPGPHLDVHAYAHMLEKRRRDPRHNPPRRRPPLSTTTLRSLAMEWSPPPTSAQIQHHRTTSPLPHSLPRQNQHIRRPQRQQQRHTNKSTAATTPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.34
3 0.31
4 0.25
5 0.22
6 0.25
7 0.23
8 0.26
9 0.28
10 0.33
11 0.41
12 0.5
13 0.57
14 0.6
15 0.68
16 0.73
17 0.8
18 0.83
19 0.85
20 0.86
21 0.91
22 0.92
23 0.88
24 0.81
25 0.76
26 0.73
27 0.69
28 0.64
29 0.56
30 0.51
31 0.46
32 0.42
33 0.35
34 0.28
35 0.22
36 0.17
37 0.14
38 0.1
39 0.11
40 0.11
41 0.11
42 0.12
43 0.12
44 0.13
45 0.17
46 0.24
47 0.31
48 0.35
49 0.37
50 0.38
51 0.36
52 0.36
53 0.35
54 0.33
55 0.29
56 0.29
57 0.29
58 0.32
59 0.38
60 0.45
61 0.5
62 0.48
63 0.52
64 0.57
65 0.62
66 0.67
67 0.72
68 0.73
69 0.74
70 0.8
71 0.8
72 0.83
73 0.85
74 0.85
75 0.86
76 0.88
77 0.87
78 0.85
79 0.81
80 0.74
81 0.7
82 0.65