Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F9X3W5

Protein Details
Accession F9X3W5   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
33-58IPNLDSPKYQKTKKRKRETDGEDKDAHydrophilic
NLS Segment(s)
PositionSequence
45-48KKRK
148-160AGGGKKKKNKGKK
Subcellular Location(s) nucl 21.5, mito_nucl 12, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR039914  SRP9-like  
IPR039432  SRP9_dom  
Gene Ontology GO:0048500  C:signal recognition particle  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
KEGG ztr:MYCGRDRAFT_68749  -  
Pfam View protein in Pfam  
PF05486  SRP9-21  
Amino Acid Sequences MPVLSSSEEWQRQSSLLLQARPTTTRITTKYNIPNLDSPKYQKTKKRKRETDGEDKDAPAAPRVPRATLTLKTYDPESGVVLKFKTDRAAEVGRLIGSLGRVGRYMAALPEKEEGLPAQDTVPEDVPAIEQAADSTLPTSDSKPQSGAGGGKKKKNKGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.31
4 0.32
5 0.32
6 0.34
7 0.36
8 0.36
9 0.34
10 0.29
11 0.27
12 0.32
13 0.33
14 0.37
15 0.37
16 0.44
17 0.51
18 0.53
19 0.52
20 0.49
21 0.51
22 0.5
23 0.51
24 0.46
25 0.42
26 0.45
27 0.49
28 0.53
29 0.55
30 0.61
31 0.68
32 0.76
33 0.82
34 0.83
35 0.83
36 0.87
37 0.86
38 0.86
39 0.82
40 0.78
41 0.68
42 0.58
43 0.52
44 0.44
45 0.35
46 0.26
47 0.22
48 0.16
49 0.21
50 0.21
51 0.21
52 0.2
53 0.23
54 0.26
55 0.24
56 0.27
57 0.24
58 0.23
59 0.23
60 0.22
61 0.19
62 0.15
63 0.13
64 0.11
65 0.1
66 0.1
67 0.1
68 0.09
69 0.1
70 0.1
71 0.1
72 0.12
73 0.11
74 0.11
75 0.15
76 0.16
77 0.16
78 0.16
79 0.16
80 0.13
81 0.13
82 0.12
83 0.08
84 0.06
85 0.07
86 0.06
87 0.06
88 0.07
89 0.07
90 0.07
91 0.07
92 0.08
93 0.08
94 0.11
95 0.11
96 0.12
97 0.13
98 0.13
99 0.12
100 0.13
101 0.11
102 0.1
103 0.11
104 0.1
105 0.09
106 0.1
107 0.11
108 0.13
109 0.14
110 0.12
111 0.11
112 0.11
113 0.11
114 0.1
115 0.1
116 0.08
117 0.06
118 0.06
119 0.07
120 0.07
121 0.07
122 0.07
123 0.06
124 0.08
125 0.1
126 0.12
127 0.19
128 0.22
129 0.24
130 0.25
131 0.26
132 0.26
133 0.28
134 0.31
135 0.32
136 0.39
137 0.44
138 0.51
139 0.59
140 0.67