Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F9XRK1

Protein Details
Accession F9XRK1    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
57-83PLGMPKTRRRLKKLRKQERNRRIAPTQBasic
NLS Segment(s)
PositionSequence
61-78PKTRRRLKKLRKQERNRR
Subcellular Location(s) nucl 19.5, cyto_nucl 14.5, cyto 6.5
Family & Domain DBs
KEGG ztr:MYCGRDRAFT_97847  -  
Amino Acid Sequences MWVIDQECLQQVDTTSRGVFTILNAAHFGNDISNGEDVKVDTLVEIRKCPKHSLSQPLGMPKTRRRLKKLRKQERNRRIAPTQSLLTLKRLDATLIQTEARSDTGFSAEIYDTVVTLGDSSNAVRKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.16
3 0.16
4 0.15
5 0.15
6 0.13
7 0.1
8 0.16
9 0.14
10 0.15
11 0.15
12 0.15
13 0.14
14 0.15
15 0.14
16 0.07
17 0.08
18 0.08
19 0.08
20 0.09
21 0.09
22 0.09
23 0.09
24 0.09
25 0.09
26 0.08
27 0.06
28 0.06
29 0.08
30 0.11
31 0.12
32 0.14
33 0.18
34 0.23
35 0.25
36 0.28
37 0.29
38 0.34
39 0.39
40 0.46
41 0.45
42 0.46
43 0.45
44 0.48
45 0.46
46 0.41
47 0.39
48 0.35
49 0.41
50 0.43
51 0.47
52 0.49
53 0.58
54 0.66
55 0.73
56 0.79
57 0.8
58 0.85
59 0.9
60 0.93
61 0.93
62 0.92
63 0.86
64 0.81
65 0.74
66 0.69
67 0.62
68 0.55
69 0.45
70 0.38
71 0.37
72 0.31
73 0.3
74 0.25
75 0.21
76 0.18
77 0.17
78 0.15
79 0.14
80 0.16
81 0.16
82 0.16
83 0.17
84 0.15
85 0.16
86 0.16
87 0.15
88 0.12
89 0.1
90 0.09
91 0.1
92 0.11
93 0.1
94 0.12
95 0.11
96 0.11
97 0.12
98 0.11
99 0.09
100 0.09
101 0.09
102 0.06
103 0.06
104 0.06
105 0.06
106 0.06
107 0.08