Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F9XJ77

Protein Details
Accession F9XJ77   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
180-203DAKDAQPSKKSKKEKKAAGKEEVFHydrophilic
NLS Segment(s)
PositionSequence
187-198SKKSKKEKKAAG
Subcellular Location(s) nucl 18, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR025602  BCP1_family  
KEGG ztr:MYCGRDRAFT_17219  -  
Pfam View protein in Pfam  
PF13862  BCCIP  
Amino Acid Sequences SDDDKSLLNVDFEWFPPNESVDFHGLKTLLRQLFDVDNQLHELSSLTDLILSQTHIGSTVKCDGEESDPYAFLTALPLSHLRAGNPALQTLATYFLSRSQSSTSPGLAETLTTLLDEDSKANIGLILTERFINMPHQIIPPLYTMLQSELSSAISSEPQFKFTHYLFLSKTYTEVASQLDAKDAQPSKKSKKEKKAAGKEEVFYFHPEDEVLQRFAVVSGAFEYEKQGEEGASDAKRAFQDLGVRPQGLIMVIEAARFEKAVEAVVEYLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.18
4 0.2
5 0.18
6 0.18
7 0.2
8 0.23
9 0.24
10 0.22
11 0.23
12 0.22
13 0.21
14 0.23
15 0.27
16 0.24
17 0.23
18 0.23
19 0.23
20 0.27
21 0.28
22 0.3
23 0.22
24 0.21
25 0.23
26 0.22
27 0.19
28 0.15
29 0.14
30 0.1
31 0.11
32 0.1
33 0.07
34 0.07
35 0.07
36 0.08
37 0.08
38 0.08
39 0.08
40 0.07
41 0.07
42 0.09
43 0.09
44 0.09
45 0.12
46 0.17
47 0.16
48 0.16
49 0.17
50 0.17
51 0.2
52 0.22
53 0.21
54 0.17
55 0.17
56 0.17
57 0.17
58 0.15
59 0.11
60 0.1
61 0.08
62 0.06
63 0.08
64 0.09
65 0.09
66 0.13
67 0.14
68 0.12
69 0.15
70 0.17
71 0.19
72 0.19
73 0.18
74 0.14
75 0.14
76 0.13
77 0.11
78 0.12
79 0.09
80 0.09
81 0.09
82 0.13
83 0.16
84 0.16
85 0.17
86 0.17
87 0.18
88 0.21
89 0.22
90 0.18
91 0.15
92 0.15
93 0.15
94 0.12
95 0.1
96 0.07
97 0.06
98 0.06
99 0.05
100 0.05
101 0.04
102 0.05
103 0.05
104 0.05
105 0.05
106 0.06
107 0.06
108 0.05
109 0.06
110 0.05
111 0.05
112 0.06
113 0.06
114 0.06
115 0.06
116 0.07
117 0.06
118 0.07
119 0.08
120 0.08
121 0.08
122 0.09
123 0.1
124 0.1
125 0.1
126 0.11
127 0.1
128 0.1
129 0.1
130 0.08
131 0.08
132 0.09
133 0.1
134 0.09
135 0.09
136 0.08
137 0.08
138 0.08
139 0.08
140 0.06
141 0.07
142 0.07
143 0.13
144 0.13
145 0.15
146 0.16
147 0.17
148 0.2
149 0.19
150 0.26
151 0.2
152 0.23
153 0.21
154 0.25
155 0.26
156 0.22
157 0.22
158 0.16
159 0.16
160 0.13
161 0.13
162 0.1
163 0.1
164 0.11
165 0.11
166 0.11
167 0.11
168 0.11
169 0.17
170 0.19
171 0.21
172 0.26
173 0.33
174 0.4
175 0.49
176 0.59
177 0.62
178 0.7
179 0.77
180 0.81
181 0.85
182 0.88
183 0.86
184 0.85
185 0.79
186 0.7
187 0.63
188 0.56
189 0.46
190 0.38
191 0.31
192 0.22
193 0.18
194 0.16
195 0.15
196 0.16
197 0.18
198 0.16
199 0.14
200 0.14
201 0.14
202 0.14
203 0.14
204 0.1
205 0.07
206 0.07
207 0.09
208 0.09
209 0.09
210 0.11
211 0.11
212 0.12
213 0.12
214 0.11
215 0.09
216 0.1
217 0.11
218 0.14
219 0.13
220 0.13
221 0.13
222 0.16
223 0.16
224 0.18
225 0.17
226 0.15
227 0.24
228 0.28
229 0.37
230 0.38
231 0.38
232 0.36
233 0.35
234 0.33
235 0.24
236 0.19
237 0.11
238 0.1
239 0.1
240 0.1
241 0.11
242 0.11
243 0.11
244 0.1
245 0.1
246 0.09
247 0.09
248 0.11
249 0.11
250 0.12