Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q0U3C9

Protein Details
Accession Q0U3C9    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
97-126MATKVEKASRQQRKQRKNRMKEFRGTAKTKHydrophilic
NLS Segment(s)
PositionSequence
103-134KASRQQRKQRKNRMKEFRGTAKTKGGAKKDKK
Subcellular Location(s) mito 17, cyto 6.5, cyto_nucl 5.5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pno:SNOG_13735  -  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MSDSQVTLRTRKFIRNPLLGRRQMVVDVLHPNRANVSKDELRGKLGELYKAKKEDVSVFGFKTHFGGGKSTGFALIYDSAEAMKKFEPRYRLVRYGMATKVEKASRQQRKQRKNRMKEFRGTAKTKGGAKKDKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.64
3 0.68
4 0.71
5 0.77
6 0.72
7 0.66
8 0.58
9 0.5
10 0.41
11 0.37
12 0.27
13 0.21
14 0.25
15 0.24
16 0.28
17 0.27
18 0.26
19 0.28
20 0.3
21 0.29
22 0.22
23 0.29
24 0.27
25 0.31
26 0.36
27 0.33
28 0.32
29 0.3
30 0.29
31 0.27
32 0.25
33 0.27
34 0.26
35 0.29
36 0.32
37 0.33
38 0.32
39 0.27
40 0.27
41 0.25
42 0.24
43 0.26
44 0.23
45 0.22
46 0.23
47 0.22
48 0.2
49 0.18
50 0.15
51 0.11
52 0.1
53 0.11
54 0.11
55 0.12
56 0.12
57 0.11
58 0.1
59 0.09
60 0.08
61 0.08
62 0.07
63 0.07
64 0.06
65 0.06
66 0.06
67 0.08
68 0.08
69 0.08
70 0.09
71 0.12
72 0.15
73 0.19
74 0.23
75 0.26
76 0.34
77 0.39
78 0.42
79 0.41
80 0.43
81 0.42
82 0.43
83 0.41
84 0.38
85 0.32
86 0.29
87 0.32
88 0.3
89 0.3
90 0.32
91 0.4
92 0.46
93 0.55
94 0.64
95 0.69
96 0.78
97 0.87
98 0.91
99 0.92
100 0.92
101 0.93
102 0.94
103 0.91
104 0.89
105 0.87
106 0.86
107 0.84
108 0.77
109 0.71
110 0.67
111 0.65
112 0.63
113 0.62
114 0.61