Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F9X816

Protein Details
Accession F9X816    Localization Confidence High Confidence Score 23.7
NoLS Segment(s)
PositionSequenceProtein Nature
12-36DTDSHYAHRRSRRPHRPAHSADHLPBasic
94-116AEYQKRRRREFEKAKAKRRREEEBasic
242-266EDEDERRYARRRPGRSRSRRAVDVSBasic
NLS Segment(s)
PositionSequence
20-45RRSRRPHRPAHSADHLPRRGARPRRT
98-119KRRRREFEKAKAKRRREEERWE
182-233RSGKGERAKSMSGKSEKAKSRSGQSERAKSRSGQSERAKSRSGKSERARSRA
247-261RRYARRRPGRSRSRR
Subcellular Location(s) nucl 18, cyto 4, plas 2, mito 1, pero 1, vacu 1
Family & Domain DBs
KEGG ztr:MYCGRDRAFT_92205  -  
Amino Acid Sequences MSPSSYYSHDSDTDSHYAHRRSRRPHRPAHSADHLPRRGARPRRTGSAPASHETSNSRSAAANIGKIALGVVFVQLVSTCLSTWMRKKEEESEAEYQKRRRREFEKAKAKRRREEERWERELEEREREKEEARWEREVTVTESRRIAPAPERGEESEEDEGMRRIEAPPEEEEEGSERGMSRSGKGERAKSMSGKSEKAKSRSGQSERAKSRSGQSERAKSRSGKSERARSRAAQSERYSSEDEDERRYARRRPGRSRSRRAVDVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.34
4 0.38
5 0.43
6 0.5
7 0.53
8 0.6
9 0.7
10 0.77
11 0.8
12 0.84
13 0.85
14 0.86
15 0.84
16 0.82
17 0.8
18 0.78
19 0.77
20 0.76
21 0.7
22 0.63
23 0.61
24 0.58
25 0.59
26 0.6
27 0.61
28 0.61
29 0.64
30 0.68
31 0.68
32 0.68
33 0.65
34 0.64
35 0.59
36 0.52
37 0.5
38 0.43
39 0.39
40 0.36
41 0.33
42 0.28
43 0.24
44 0.22
45 0.19
46 0.2
47 0.25
48 0.23
49 0.21
50 0.17
51 0.17
52 0.16
53 0.15
54 0.14
55 0.07
56 0.06
57 0.05
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.05
64 0.05
65 0.05
66 0.05
67 0.08
68 0.1
69 0.14
70 0.2
71 0.27
72 0.29
73 0.31
74 0.34
75 0.38
76 0.43
77 0.43
78 0.43
79 0.42
80 0.44
81 0.48
82 0.49
83 0.49
84 0.48
85 0.53
86 0.5
87 0.52
88 0.52
89 0.59
90 0.65
91 0.7
92 0.76
93 0.77
94 0.84
95 0.86
96 0.86
97 0.82
98 0.79
99 0.78
100 0.74
101 0.76
102 0.76
103 0.75
104 0.73
105 0.67
106 0.61
107 0.54
108 0.54
109 0.45
110 0.42
111 0.36
112 0.33
113 0.33
114 0.33
115 0.31
116 0.27
117 0.33
118 0.33
119 0.34
120 0.35
121 0.33
122 0.33
123 0.32
124 0.31
125 0.26
126 0.25
127 0.24
128 0.22
129 0.23
130 0.23
131 0.22
132 0.21
133 0.19
134 0.16
135 0.21
136 0.22
137 0.22
138 0.24
139 0.24
140 0.26
141 0.25
142 0.24
143 0.18
144 0.15
145 0.14
146 0.12
147 0.12
148 0.1
149 0.1
150 0.07
151 0.07
152 0.1
153 0.1
154 0.12
155 0.13
156 0.16
157 0.18
158 0.17
159 0.17
160 0.16
161 0.16
162 0.14
163 0.12
164 0.1
165 0.09
166 0.12
167 0.12
168 0.11
169 0.17
170 0.19
171 0.26
172 0.3
173 0.34
174 0.35
175 0.39
176 0.41
177 0.38
178 0.39
179 0.4
180 0.4
181 0.41
182 0.41
183 0.45
184 0.49
185 0.5
186 0.53
187 0.48
188 0.52
189 0.57
190 0.59
191 0.6
192 0.61
193 0.67
194 0.67
195 0.68
196 0.62
197 0.54
198 0.56
199 0.56
200 0.53
201 0.52
202 0.55
203 0.6
204 0.64
205 0.66
206 0.65
207 0.59
208 0.6
209 0.6
210 0.58
211 0.58
212 0.61
213 0.67
214 0.7
215 0.72
216 0.71
217 0.65
218 0.66
219 0.65
220 0.62
221 0.61
222 0.56
223 0.58
224 0.55
225 0.55
226 0.51
227 0.42
228 0.41
229 0.39
230 0.38
231 0.36
232 0.37
233 0.35
234 0.39
235 0.43
236 0.46
237 0.5
238 0.57
239 0.61
240 0.69
241 0.78
242 0.82
243 0.88
244 0.92
245 0.92
246 0.9