Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F9XED6

Protein Details
Accession F9XED6   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
12-38DQYLQVPKRLHNRKARSKSRERASEIMHydrophilic
NLS Segment(s)
PositionSequence
22-31HNRKARSKSR
Subcellular Location(s) nucl 17, cyto_nucl 12, cyto 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR024311  Lipocalin-like  
KEGG ztr:MYCGRDRAFT_93658  -  
Pfam View protein in Pfam  
PF13924  Lipocalin_5  
Amino Acid Sequences MPTATMTTRQSDQYLQVPKRLHNRKARSKSRERASEIMTGHVDIPSDSQVIVSPQKLSFRSRSPPLPIRPEPFRRAASYNNLGTPAHNNGVESPLAVQSIYTPPTPLRVTTLTPPPSKSPYQPFSPPPLSPPLTPPPTSSQRQSPSAPTLRSLLIGTWTLESYIAYPTPSSPLQRPTFPMTRSVTGFILYTPDGYMSATMLIPGQKPFQRGSGGNDEAQWAEAGKRCFGYCGPYYISLSPAEGDVDEDGKQREVLRHTFQCCSLPGWVGDVQVRTHRFEEEGEVLVLGSEGPTEIKGDKRIPVLKWRRARDNSTASPPAPTPQIKISGPGEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.4
3 0.44
4 0.45
5 0.48
6 0.56
7 0.62
8 0.64
9 0.64
10 0.73
11 0.78
12 0.85
13 0.9
14 0.89
15 0.9
16 0.91
17 0.9
18 0.89
19 0.85
20 0.8
21 0.73
22 0.69
23 0.59
24 0.53
25 0.44
26 0.36
27 0.29
28 0.24
29 0.2
30 0.13
31 0.14
32 0.11
33 0.11
34 0.1
35 0.09
36 0.1
37 0.13
38 0.16
39 0.15
40 0.16
41 0.18
42 0.23
43 0.26
44 0.3
45 0.32
46 0.35
47 0.41
48 0.44
49 0.49
50 0.52
51 0.58
52 0.61
53 0.65
54 0.65
55 0.63
56 0.66
57 0.68
58 0.65
59 0.62
60 0.58
61 0.52
62 0.5
63 0.49
64 0.48
65 0.47
66 0.44
67 0.39
68 0.37
69 0.33
70 0.31
71 0.29
72 0.25
73 0.2
74 0.18
75 0.17
76 0.16
77 0.18
78 0.17
79 0.14
80 0.11
81 0.09
82 0.09
83 0.09
84 0.08
85 0.08
86 0.11
87 0.12
88 0.11
89 0.12
90 0.12
91 0.16
92 0.17
93 0.16
94 0.17
95 0.17
96 0.2
97 0.23
98 0.31
99 0.33
100 0.34
101 0.35
102 0.35
103 0.37
104 0.38
105 0.38
106 0.38
107 0.37
108 0.4
109 0.43
110 0.43
111 0.45
112 0.47
113 0.41
114 0.36
115 0.38
116 0.36
117 0.31
118 0.33
119 0.33
120 0.33
121 0.34
122 0.33
123 0.33
124 0.37
125 0.39
126 0.36
127 0.36
128 0.37
129 0.4
130 0.39
131 0.36
132 0.37
133 0.39
134 0.37
135 0.31
136 0.28
137 0.25
138 0.24
139 0.21
140 0.14
141 0.1
142 0.1
143 0.1
144 0.08
145 0.08
146 0.07
147 0.07
148 0.07
149 0.06
150 0.06
151 0.06
152 0.06
153 0.06
154 0.06
155 0.09
156 0.1
157 0.11
158 0.12
159 0.19
160 0.21
161 0.23
162 0.26
163 0.29
164 0.33
165 0.31
166 0.35
167 0.31
168 0.31
169 0.31
170 0.3
171 0.24
172 0.19
173 0.19
174 0.13
175 0.12
176 0.1
177 0.09
178 0.07
179 0.07
180 0.06
181 0.06
182 0.06
183 0.04
184 0.05
185 0.05
186 0.05
187 0.05
188 0.06
189 0.07
190 0.08
191 0.12
192 0.13
193 0.16
194 0.17
195 0.19
196 0.21
197 0.22
198 0.26
199 0.3
200 0.3
201 0.29
202 0.28
203 0.26
204 0.23
205 0.22
206 0.16
207 0.08
208 0.08
209 0.11
210 0.12
211 0.12
212 0.13
213 0.13
214 0.14
215 0.14
216 0.18
217 0.16
218 0.19
219 0.2
220 0.21
221 0.24
222 0.23
223 0.24
224 0.18
225 0.17
226 0.14
227 0.12
228 0.1
229 0.08
230 0.08
231 0.07
232 0.08
233 0.08
234 0.1
235 0.11
236 0.11
237 0.12
238 0.13
239 0.17
240 0.2
241 0.25
242 0.31
243 0.37
244 0.4
245 0.41
246 0.41
247 0.39
248 0.36
249 0.32
250 0.27
251 0.22
252 0.19
253 0.2
254 0.19
255 0.18
256 0.19
257 0.19
258 0.18
259 0.23
260 0.25
261 0.25
262 0.25
263 0.25
264 0.24
265 0.23
266 0.27
267 0.23
268 0.22
269 0.19
270 0.18
271 0.17
272 0.15
273 0.14
274 0.08
275 0.05
276 0.03
277 0.04
278 0.04
279 0.05
280 0.07
281 0.09
282 0.13
283 0.18
284 0.22
285 0.25
286 0.33
287 0.38
288 0.4
289 0.5
290 0.56
291 0.61
292 0.67
293 0.71
294 0.74
295 0.75
296 0.78
297 0.77
298 0.76
299 0.74
300 0.73
301 0.71
302 0.6
303 0.57
304 0.51
305 0.45
306 0.42
307 0.37
308 0.32
309 0.32
310 0.38
311 0.35
312 0.39