Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F9X6Q5

Protein Details
Accession F9X6Q5    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
539-563QSHTGAGQRRPAKRKKADPAIYQAAHydrophilic
NLS Segment(s)
PositionSequence
547-554RRPAKRKK
Subcellular Location(s) nucl 13, cyto_nucl 10.5, cyto 6, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005123  Oxoglu/Fe-dep_dioxygenase  
IPR019601  Oxoglutarate/Fe-dep_Oase_C  
IPR006620  Pro_4_hyd_alph  
IPR043044  TPA1/Ofd1_C  
IPR039558  TPA1/OFD1_N  
Gene Ontology GO:0005634  C:nucleus  
GO:0008198  F:ferrous iron binding  
GO:0031418  F:L-ascorbic acid binding  
GO:0019826  F:oxygen sensor activity  
GO:0031543  F:peptidyl-proline dioxygenase activity  
GO:0008143  F:poly(A) binding  
GO:0140311  F:protein sequestering activity  
GO:0071456  P:cellular response to hypoxia  
GO:2000639  P:negative regulation of SREBP signaling pathway  
GO:0000288  P:nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay  
GO:0018188  P:peptidyl-proline di-hydroxylation  
GO:0032436  P:positive regulation of proteasomal ubiquitin-dependent protein catabolic process  
GO:0006450  P:regulation of translational fidelity  
GO:0006449  P:regulation of translational termination  
GO:0006415  P:translational termination  
KEGG ztr:MYCGRDRAFT_108541  -  
Pfam View protein in Pfam  
PF13661  2OG-FeII_Oxy_4  
PF10637  Ofd1_CTDD  
PROSITE View protein in PROSITE  
PS51471  FE2OG_OXY  
Amino Acid Sequences MKRKAAETDAGAKGNGKKRAVEVSNVQDRFREGLFKPETVDAYTNEYAKSSPYKHAVVSDLINDELLRSVRSEIVNSIHFTPKETDIYKIHQSGDLANLDGLPAEALQKLPSLLKLRDAMYGKEFREWISHVSGAGAVSGKKTDMAVNLYVPGCHLLCHDDVIGSRRVSYILYLTDPDIPWQAEWGGALRLYPTDEVKDDSGKTFKLPQSSWNKVIPPAWNQLSFFAVQPGESFHDVEEVYKRASGESEQDGGRFRMAISGWFHIPQEGEDGYEPGLEERLAEKSSLQQLQGKADEVDEPQQQWIAPTEPKASSEDEEVELTPEDLQFLIKYITPNYLTPDTVEELTELFTEESILQLTNFLSDKFSKKLKEWFDQNQGDDLSFATSRPPHKHRYQYLQAQPGSVEGSGPNASPLRQVLDELLPSMPFRKWLSVLTGLTLKRSSIMARRFRRSLDYQLAQGYEGEDPQLEYTLCITPTVGWGGEEESAAEEGETIGKTKKADNDEEDNAGGYELYMAGDDPDDDEDGSDDGVNIPANVQSHTGAGQRRPAKRKKADPAIYQAAGEDEDDGILFSNAASWNTMSFVLRDRGTLKFVKYVSKAAPGDRYDITGCVEVEPEDDDDEDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.47
3 0.41
4 0.39
5 0.42
6 0.51
7 0.5
8 0.48
9 0.48
10 0.5
11 0.58
12 0.57
13 0.53
14 0.45
15 0.44
16 0.41
17 0.34
18 0.32
19 0.23
20 0.31
21 0.34
22 0.34
23 0.34
24 0.35
25 0.35
26 0.32
27 0.33
28 0.25
29 0.29
30 0.3
31 0.29
32 0.26
33 0.25
34 0.21
35 0.23
36 0.28
37 0.24
38 0.28
39 0.32
40 0.35
41 0.35
42 0.38
43 0.38
44 0.34
45 0.32
46 0.29
47 0.25
48 0.23
49 0.21
50 0.18
51 0.15
52 0.15
53 0.14
54 0.11
55 0.1
56 0.12
57 0.16
58 0.17
59 0.18
60 0.18
61 0.21
62 0.24
63 0.25
64 0.27
65 0.29
66 0.28
67 0.3
68 0.31
69 0.31
70 0.34
71 0.33
72 0.34
73 0.31
74 0.37
75 0.4
76 0.4
77 0.37
78 0.33
79 0.33
80 0.3
81 0.31
82 0.26
83 0.21
84 0.18
85 0.16
86 0.14
87 0.13
88 0.11
89 0.06
90 0.05
91 0.05
92 0.06
93 0.06
94 0.07
95 0.08
96 0.09
97 0.1
98 0.15
99 0.19
100 0.19
101 0.24
102 0.26
103 0.27
104 0.33
105 0.34
106 0.31
107 0.32
108 0.37
109 0.34
110 0.34
111 0.33
112 0.27
113 0.29
114 0.28
115 0.25
116 0.23
117 0.23
118 0.19
119 0.19
120 0.19
121 0.15
122 0.14
123 0.12
124 0.08
125 0.09
126 0.09
127 0.09
128 0.08
129 0.09
130 0.1
131 0.12
132 0.15
133 0.16
134 0.16
135 0.19
136 0.19
137 0.18
138 0.16
139 0.16
140 0.12
141 0.11
142 0.11
143 0.1
144 0.11
145 0.12
146 0.12
147 0.11
148 0.12
149 0.15
150 0.19
151 0.16
152 0.16
153 0.15
154 0.16
155 0.15
156 0.15
157 0.13
158 0.11
159 0.12
160 0.12
161 0.13
162 0.16
163 0.16
164 0.16
165 0.16
166 0.15
167 0.13
168 0.13
169 0.12
170 0.09
171 0.09
172 0.09
173 0.08
174 0.07
175 0.07
176 0.07
177 0.07
178 0.08
179 0.09
180 0.09
181 0.1
182 0.11
183 0.13
184 0.14
185 0.16
186 0.16
187 0.17
188 0.18
189 0.17
190 0.18
191 0.23
192 0.24
193 0.27
194 0.26
195 0.33
196 0.4
197 0.46
198 0.48
199 0.45
200 0.44
201 0.4
202 0.43
203 0.38
204 0.34
205 0.34
206 0.33
207 0.31
208 0.3
209 0.29
210 0.27
211 0.24
212 0.19
213 0.15
214 0.12
215 0.1
216 0.1
217 0.11
218 0.12
219 0.12
220 0.12
221 0.09
222 0.11
223 0.11
224 0.12
225 0.13
226 0.12
227 0.11
228 0.12
229 0.12
230 0.1
231 0.11
232 0.11
233 0.12
234 0.14
235 0.16
236 0.15
237 0.15
238 0.17
239 0.17
240 0.16
241 0.12
242 0.1
243 0.1
244 0.1
245 0.12
246 0.13
247 0.14
248 0.15
249 0.16
250 0.16
251 0.14
252 0.14
253 0.1
254 0.11
255 0.09
256 0.09
257 0.08
258 0.09
259 0.08
260 0.08
261 0.08
262 0.05
263 0.06
264 0.05
265 0.05
266 0.05
267 0.07
268 0.07
269 0.08
270 0.08
271 0.11
272 0.16
273 0.17
274 0.17
275 0.19
276 0.2
277 0.22
278 0.23
279 0.2
280 0.16
281 0.15
282 0.15
283 0.12
284 0.14
285 0.12
286 0.12
287 0.11
288 0.11
289 0.11
290 0.1
291 0.1
292 0.1
293 0.1
294 0.11
295 0.13
296 0.13
297 0.15
298 0.16
299 0.16
300 0.14
301 0.15
302 0.14
303 0.12
304 0.13
305 0.12
306 0.11
307 0.09
308 0.09
309 0.07
310 0.06
311 0.05
312 0.05
313 0.05
314 0.04
315 0.05
316 0.05
317 0.06
318 0.07
319 0.08
320 0.1
321 0.12
322 0.12
323 0.15
324 0.16
325 0.15
326 0.15
327 0.16
328 0.14
329 0.13
330 0.13
331 0.09
332 0.08
333 0.09
334 0.08
335 0.07
336 0.05
337 0.05
338 0.05
339 0.05
340 0.05
341 0.05
342 0.05
343 0.04
344 0.05
345 0.05
346 0.06
347 0.07
348 0.07
349 0.08
350 0.1
351 0.13
352 0.16
353 0.2
354 0.21
355 0.24
356 0.31
357 0.35
358 0.4
359 0.44
360 0.48
361 0.53
362 0.54
363 0.52
364 0.47
365 0.41
366 0.34
367 0.28
368 0.21
369 0.13
370 0.1
371 0.09
372 0.09
373 0.12
374 0.17
375 0.24
376 0.28
377 0.34
378 0.41
379 0.51
380 0.55
381 0.61
382 0.64
383 0.67
384 0.69
385 0.7
386 0.63
387 0.54
388 0.47
389 0.39
390 0.31
391 0.21
392 0.15
393 0.07
394 0.09
395 0.09
396 0.09
397 0.1
398 0.09
399 0.1
400 0.1
401 0.11
402 0.11
403 0.11
404 0.12
405 0.12
406 0.13
407 0.13
408 0.13
409 0.13
410 0.1
411 0.1
412 0.12
413 0.1
414 0.12
415 0.13
416 0.14
417 0.15
418 0.17
419 0.21
420 0.25
421 0.25
422 0.23
423 0.27
424 0.25
425 0.26
426 0.24
427 0.2
428 0.15
429 0.16
430 0.17
431 0.19
432 0.28
433 0.36
434 0.44
435 0.5
436 0.51
437 0.52
438 0.56
439 0.53
440 0.52
441 0.51
442 0.45
443 0.41
444 0.42
445 0.4
446 0.34
447 0.29
448 0.22
449 0.13
450 0.11
451 0.1
452 0.07
453 0.07
454 0.07
455 0.09
456 0.07
457 0.07
458 0.09
459 0.11
460 0.11
461 0.11
462 0.1
463 0.09
464 0.11
465 0.12
466 0.1
467 0.08
468 0.09
469 0.1
470 0.1
471 0.1
472 0.08
473 0.08
474 0.08
475 0.08
476 0.07
477 0.06
478 0.05
479 0.07
480 0.07
481 0.07
482 0.09
483 0.11
484 0.12
485 0.16
486 0.22
487 0.26
488 0.32
489 0.37
490 0.42
491 0.43
492 0.44
493 0.41
494 0.35
495 0.29
496 0.23
497 0.17
498 0.1
499 0.07
500 0.05
501 0.05
502 0.04
503 0.04
504 0.04
505 0.05
506 0.05
507 0.06
508 0.07
509 0.07
510 0.07
511 0.08
512 0.08
513 0.08
514 0.09
515 0.08
516 0.06
517 0.06
518 0.08
519 0.08
520 0.07
521 0.07
522 0.08
523 0.09
524 0.1
525 0.11
526 0.11
527 0.11
528 0.13
529 0.18
530 0.2
531 0.22
532 0.3
533 0.37
534 0.45
535 0.54
536 0.62
537 0.68
538 0.74
539 0.82
540 0.84
541 0.87
542 0.87
543 0.83
544 0.83
545 0.8
546 0.7
547 0.6
548 0.49
549 0.39
550 0.31
551 0.24
552 0.16
553 0.08
554 0.07
555 0.07
556 0.07
557 0.07
558 0.06
559 0.06
560 0.05
561 0.08
562 0.09
563 0.1
564 0.11
565 0.11
566 0.11
567 0.13
568 0.15
569 0.12
570 0.12
571 0.17
572 0.21
573 0.21
574 0.23
575 0.24
576 0.25
577 0.29
578 0.33
579 0.3
580 0.32
581 0.33
582 0.39
583 0.39
584 0.43
585 0.41
586 0.46
587 0.45
588 0.43
589 0.5
590 0.43
591 0.45
592 0.4
593 0.4
594 0.32
595 0.31
596 0.29
597 0.24
598 0.23
599 0.19
600 0.19
601 0.16
602 0.16
603 0.16
604 0.15
605 0.13
606 0.13