Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F9WZ91

Protein Details
Accession F9WZ91    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
58-78NPYPPTSAWRKNARCRLPNKNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 12.5, cyto_nucl 8.5
Family & Domain DBs
KEGG ztr:MYCGRDRAFT_78544  -  
Amino Acid Sequences IPSPPTRRPLANASNPTQAPSAPKPTSNWVPNPSKKLTRPTTSSPTSGPSNAFSRTANPYPPTSAWRKNARCRLPNKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.56
3 0.53
4 0.44
5 0.36
6 0.32
7 0.3
8 0.34
9 0.28
10 0.3
11 0.31
12 0.37
13 0.43
14 0.42
15 0.42
16 0.41
17 0.48
18 0.51
19 0.54
20 0.52
21 0.5
22 0.49
23 0.53
24 0.52
25 0.48
26 0.48
27 0.49
28 0.51
29 0.48
30 0.46
31 0.38
32 0.35
33 0.33
34 0.29
35 0.24
36 0.2
37 0.2
38 0.2
39 0.21
40 0.18
41 0.19
42 0.25
43 0.26
44 0.28
45 0.28
46 0.28
47 0.31
48 0.33
49 0.35
50 0.36
51 0.42
52 0.45
53 0.53
54 0.6
55 0.67
56 0.75
57 0.8
58 0.81