Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F9WYH1

Protein Details
Accession F9WYH1    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
109-135AKEEVRGKFHKRIRRKREVQDAEKWDVBasic
NLS Segment(s)
PositionSequence
113-125VRGKFHKRIRRKR
Subcellular Location(s) nucl 12.5, cyto_nucl 10.666, mito_nucl 9.999, cyto_mito 6.999, cyto 6.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR003837  Asp/Glu-ADT_csu  
Gene Ontology GO:0006450  P:regulation of translational fidelity  
KEGG ztr:MYCGRDRAFT_28532  -  
Pfam View protein in Pfam  
PF02686  Glu-tRNAGln  
Amino Acid Sequences KQLDVEALLSKPTWSVASLLPSDTAATETPKVSSTQLHHLLRLSALPPPTSPVEETAMLQTLTSQLHFVKQVQSVDTTNVEPLRSLRDETEEGEKEAELGLEALKGALAKEEVRGKFHKRIRRKREVQDAEKWDVLGHAERKTGRYFVVEGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.13
4 0.17
5 0.18
6 0.18
7 0.18
8 0.17
9 0.16
10 0.14
11 0.14
12 0.1
13 0.12
14 0.13
15 0.13
16 0.14
17 0.14
18 0.15
19 0.15
20 0.18
21 0.19
22 0.26
23 0.34
24 0.34
25 0.35
26 0.34
27 0.34
28 0.29
29 0.27
30 0.19
31 0.14
32 0.14
33 0.13
34 0.13
35 0.15
36 0.16
37 0.16
38 0.16
39 0.15
40 0.16
41 0.16
42 0.17
43 0.14
44 0.14
45 0.12
46 0.12
47 0.09
48 0.08
49 0.08
50 0.07
51 0.07
52 0.06
53 0.08
54 0.09
55 0.1
56 0.12
57 0.14
58 0.15
59 0.14
60 0.16
61 0.15
62 0.16
63 0.16
64 0.13
65 0.12
66 0.12
67 0.11
68 0.09
69 0.09
70 0.12
71 0.12
72 0.12
73 0.11
74 0.15
75 0.16
76 0.17
77 0.23
78 0.2
79 0.19
80 0.19
81 0.18
82 0.15
83 0.14
84 0.12
85 0.05
86 0.05
87 0.04
88 0.04
89 0.04
90 0.03
91 0.04
92 0.04
93 0.04
94 0.04
95 0.05
96 0.06
97 0.1
98 0.17
99 0.18
100 0.22
101 0.27
102 0.32
103 0.4
104 0.48
105 0.54
106 0.58
107 0.68
108 0.74
109 0.81
110 0.85
111 0.85
112 0.9
113 0.9
114 0.86
115 0.85
116 0.81
117 0.75
118 0.66
119 0.56
120 0.45
121 0.35
122 0.31
123 0.28
124 0.25
125 0.22
126 0.25
127 0.27
128 0.3
129 0.33
130 0.32
131 0.27
132 0.27