Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F9X745

Protein Details
Accession F9X745   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
97-126QATKIEKASRQQRKQRKNRGKETRGTAKTKHydrophilic
NLS Segment(s)
PositionSequence
103-134KASRQQRKQRKNRGKETRGTAKTKAASKDKKK
Subcellular Location(s) mito 22, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ztr:MYCGRDRAFT_70471  -  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MSDSQVTLRTRKFIRNPLLGRKQMVVDVLHPSRANVSKDELREKLGQLYKTSKDQVSVFGFRTQFGGGKSTGFALLYDSAEAMKKFEPHYRLVRYGQATKIEKASRQQRKQRKNRGKETRGTAKTKAASKDKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.64
3 0.68
4 0.72
5 0.78
6 0.72
7 0.66
8 0.59
9 0.51
10 0.42
11 0.38
12 0.29
13 0.21
14 0.25
15 0.23
16 0.24
17 0.23
18 0.21
19 0.24
20 0.28
21 0.28
22 0.22
23 0.27
24 0.28
25 0.32
26 0.37
27 0.34
28 0.33
29 0.33
30 0.32
31 0.34
32 0.34
33 0.32
34 0.29
35 0.33
36 0.32
37 0.33
38 0.35
39 0.28
40 0.26
41 0.25
42 0.27
43 0.26
44 0.26
45 0.24
46 0.25
47 0.25
48 0.22
49 0.23
50 0.18
51 0.15
52 0.13
53 0.14
54 0.1
55 0.1
56 0.1
57 0.09
58 0.09
59 0.07
60 0.07
61 0.06
62 0.07
63 0.07
64 0.07
65 0.06
66 0.06
67 0.08
68 0.08
69 0.08
70 0.08
71 0.1
72 0.12
73 0.17
74 0.2
75 0.24
76 0.32
77 0.35
78 0.38
79 0.38
80 0.42
81 0.41
82 0.42
83 0.41
84 0.42
85 0.4
86 0.37
87 0.42
88 0.38
89 0.37
90 0.41
91 0.48
92 0.51
93 0.58
94 0.67
95 0.71
96 0.8
97 0.88
98 0.91
99 0.92
100 0.91
101 0.93
102 0.94
103 0.92
104 0.89
105 0.88
106 0.87
107 0.84
108 0.79
109 0.71
110 0.68
111 0.65
112 0.63
113 0.62
114 0.62