Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F9XN20

Protein Details
Accession F9XN20    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
102-121AEKAADKKGIKRNRKEHLLLBasic
NLS Segment(s)
PositionSequence
67-72MKKLPK
101-116KAEKAADKKGIKRNRK
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
KEGG ztr:MYCGRDRAFT_96646  -  
Amino Acid Sequences MTYKYKHLFLEAQDEEESDATEMDNPYAGDPLIACIGFLEPARVECLTHVQSKKLLRLVIEGEFRKMKKLPKLHVRGEPKFYERIRQIAPRVIEWEERVVKAEKAADKKGIKRNRKEHLLLWNCRELSPSDRIKEGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.27
3 0.23
4 0.21
5 0.11
6 0.1
7 0.07
8 0.1
9 0.1
10 0.09
11 0.1
12 0.1
13 0.1
14 0.1
15 0.1
16 0.07
17 0.07
18 0.08
19 0.08
20 0.07
21 0.07
22 0.06
23 0.07
24 0.08
25 0.08
26 0.08
27 0.07
28 0.07
29 0.1
30 0.09
31 0.09
32 0.09
33 0.14
34 0.15
35 0.22
36 0.22
37 0.22
38 0.26
39 0.29
40 0.32
41 0.3
42 0.28
43 0.22
44 0.23
45 0.24
46 0.23
47 0.26
48 0.22
49 0.22
50 0.24
51 0.23
52 0.24
53 0.24
54 0.26
55 0.28
56 0.34
57 0.39
58 0.46
59 0.54
60 0.56
61 0.61
62 0.65
63 0.61
64 0.6
65 0.55
66 0.47
67 0.47
68 0.42
69 0.41
70 0.34
71 0.35
72 0.33
73 0.35
74 0.36
75 0.35
76 0.35
77 0.3
78 0.31
79 0.28
80 0.27
81 0.23
82 0.26
83 0.23
84 0.22
85 0.23
86 0.22
87 0.21
88 0.21
89 0.24
90 0.24
91 0.27
92 0.3
93 0.35
94 0.39
95 0.47
96 0.55
97 0.6
98 0.64
99 0.69
100 0.76
101 0.77
102 0.81
103 0.77
104 0.73
105 0.74
106 0.74
107 0.71
108 0.67
109 0.64
110 0.56
111 0.52
112 0.48
113 0.4
114 0.36
115 0.37
116 0.39
117 0.35