Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F9XKG7

Protein Details
Accession F9XKG7    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
35-61STARTRAKYRCEKKQTRCRIIKHHFVSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 12
Family & Domain DBs
KEGG ztr:MYCGRDRAFT_105810  -  
Amino Acid Sequences MFYTVTLKASTVELNRLTDRDLERNPACVHAKAPSTARTRAKYRCEKKQTRCRIIKHHFVSALSSWPGNPCFSTQRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.24
4 0.24
5 0.25
6 0.27
7 0.28
8 0.27
9 0.31
10 0.3
11 0.34
12 0.33
13 0.34
14 0.33
15 0.27
16 0.26
17 0.23
18 0.24
19 0.21
20 0.23
21 0.24
22 0.26
23 0.32
24 0.36
25 0.36
26 0.4
27 0.45
28 0.52
29 0.56
30 0.59
31 0.63
32 0.69
33 0.75
34 0.8
35 0.84
36 0.86
37 0.86
38 0.87
39 0.83
40 0.83
41 0.81
42 0.81
43 0.74
44 0.69
45 0.61
46 0.53
47 0.5
48 0.41
49 0.38
50 0.28
51 0.25
52 0.19
53 0.21
54 0.22
55 0.2
56 0.2
57 0.19