Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F9XJ50

Protein Details
Accession F9XJ50    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
125-144YLYGHPQGRKKRYRSPADFFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038986  Clr2  
IPR031915  Clr2_N  
Gene Ontology GO:0070824  C:SHREC complex  
GO:0031507  P:heterochromatin formation  
KEGG ztr:MYCGRDRAFT_105665  -  
Pfam View protein in Pfam  
PF16761  Clr2_transil  
Amino Acid Sequences MAPFYPIYIRRSDGKLAVTAHSRKETNEPTAEQLDQKPDKNGISDYYRQVQPDEPKHLDWRRKIGGMLARELRYKDKNADSGYILATFPENYRLYEHVKRKEVDGKLEIKSKTHAAGGNDRQDAYLYGHPQGRKKRYRSPADFFAHVLWLATDESGDPDNCSCKICSPED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.34
3 0.33
4 0.34
5 0.36
6 0.36
7 0.37
8 0.38
9 0.37
10 0.34
11 0.41
12 0.43
13 0.41
14 0.43
15 0.4
16 0.39
17 0.41
18 0.4
19 0.35
20 0.32
21 0.34
22 0.33
23 0.33
24 0.32
25 0.32
26 0.31
27 0.3
28 0.29
29 0.25
30 0.27
31 0.29
32 0.3
33 0.32
34 0.33
35 0.31
36 0.32
37 0.33
38 0.35
39 0.38
40 0.42
41 0.39
42 0.39
43 0.47
44 0.53
45 0.54
46 0.5
47 0.51
48 0.47
49 0.45
50 0.43
51 0.4
52 0.38
53 0.32
54 0.33
55 0.29
56 0.27
57 0.28
58 0.29
59 0.28
60 0.26
61 0.26
62 0.26
63 0.25
64 0.29
65 0.28
66 0.29
67 0.25
68 0.23
69 0.22
70 0.18
71 0.14
72 0.1
73 0.09
74 0.07
75 0.07
76 0.11
77 0.11
78 0.11
79 0.12
80 0.15
81 0.2
82 0.28
83 0.35
84 0.37
85 0.41
86 0.41
87 0.42
88 0.48
89 0.44
90 0.42
91 0.39
92 0.37
93 0.35
94 0.4
95 0.37
96 0.31
97 0.31
98 0.27
99 0.24
100 0.22
101 0.23
102 0.2
103 0.28
104 0.33
105 0.37
106 0.37
107 0.35
108 0.33
109 0.3
110 0.28
111 0.23
112 0.22
113 0.17
114 0.2
115 0.24
116 0.26
117 0.33
118 0.41
119 0.47
120 0.52
121 0.58
122 0.65
123 0.71
124 0.79
125 0.81
126 0.79
127 0.78
128 0.75
129 0.69
130 0.61
131 0.52
132 0.42
133 0.33
134 0.26
135 0.16
136 0.12
137 0.11
138 0.09
139 0.08
140 0.07
141 0.09
142 0.11
143 0.12
144 0.12
145 0.13
146 0.16
147 0.17
148 0.19
149 0.18
150 0.21