Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0CBE0

Protein Details
Accession Q0CBE0    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
70-89NKKSVKKTGKPAKKDGKGIRBasic
NLS Segment(s)
PositionSequence
70-87NKKSVKKTGKPAKKDGKG
Subcellular Location(s) mito_nucl 10.166, nucl 10, mito 10, cyto_nucl 8.333
Family & Domain DBs
Amino Acid Sequences MVLTVVLSQKARFMINDSDWCGVPVYGVIHLPACWFPSTNADQQGPDVPPFMIDKMKWEWRNVERQKFFNKKSVKKTGKPAKKDGKGIREMVLLNLLMYFMRFDFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.27
3 0.31
4 0.32
5 0.32
6 0.31
7 0.31
8 0.27
9 0.2
10 0.15
11 0.12
12 0.09
13 0.08
14 0.09
15 0.08
16 0.08
17 0.08
18 0.09
19 0.09
20 0.09
21 0.09
22 0.09
23 0.1
24 0.15
25 0.18
26 0.21
27 0.23
28 0.23
29 0.22
30 0.22
31 0.25
32 0.21
33 0.17
34 0.15
35 0.11
36 0.11
37 0.11
38 0.12
39 0.1
40 0.08
41 0.11
42 0.15
43 0.23
44 0.24
45 0.25
46 0.3
47 0.32
48 0.43
49 0.48
50 0.53
51 0.49
52 0.52
53 0.61
54 0.64
55 0.63
56 0.6
57 0.62
58 0.61
59 0.66
60 0.73
61 0.72
62 0.69
63 0.77
64 0.8
65 0.8
66 0.78
67 0.8
68 0.79
69 0.77
70 0.81
71 0.78
72 0.76
73 0.73
74 0.68
75 0.6
76 0.53
77 0.46
78 0.38
79 0.32
80 0.23
81 0.17
82 0.14
83 0.12
84 0.09
85 0.08
86 0.08