Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0CCN4

Protein Details
Accession Q0CCN4   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
80-102LLTTSEKKAQPRRKPPMNRISLSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022214  MZT1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0000931  C:gamma-tubulin ring complex  
GO:0005816  C:spindle pole body  
GO:0033566  P:gamma-tubulin complex localization  
Pfam View protein in Pfam  
PF12554  MOZART1  
Amino Acid Sequences MPSQADDKRQAAREVIDILHEISMLLNTNLDRTELSLCVSLIENGVNPDALAVGLPTVVIYTGVFTYPVQFYGLMLDRRLLTTSEKKAQPRRKPPMNRISLSDCLLDSSDHFFVHSLFSMLMTEIPVVQALIQMVQSMYV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.28
3 0.22
4 0.19
5 0.18
6 0.15
7 0.13
8 0.1
9 0.08
10 0.08
11 0.08
12 0.07
13 0.07
14 0.07
15 0.08
16 0.09
17 0.09
18 0.08
19 0.09
20 0.11
21 0.1
22 0.12
23 0.12
24 0.11
25 0.12
26 0.12
27 0.11
28 0.09
29 0.09
30 0.08
31 0.08
32 0.08
33 0.07
34 0.06
35 0.05
36 0.05
37 0.04
38 0.04
39 0.03
40 0.03
41 0.02
42 0.02
43 0.02
44 0.02
45 0.02
46 0.03
47 0.03
48 0.03
49 0.04
50 0.04
51 0.05
52 0.05
53 0.06
54 0.06
55 0.07
56 0.07
57 0.07
58 0.07
59 0.09
60 0.12
61 0.11
62 0.11
63 0.12
64 0.11
65 0.12
66 0.13
67 0.11
68 0.12
69 0.18
70 0.23
71 0.29
72 0.33
73 0.4
74 0.49
75 0.58
76 0.64
77 0.68
78 0.73
79 0.77
80 0.82
81 0.85
82 0.86
83 0.84
84 0.76
85 0.7
86 0.66
87 0.58
88 0.51
89 0.41
90 0.31
91 0.24
92 0.22
93 0.18
94 0.13
95 0.14
96 0.14
97 0.13
98 0.13
99 0.12
100 0.12
101 0.14
102 0.13
103 0.1
104 0.08
105 0.09
106 0.09
107 0.09
108 0.09
109 0.08
110 0.08
111 0.07
112 0.07
113 0.07
114 0.06
115 0.06
116 0.07
117 0.07
118 0.07
119 0.07
120 0.07