Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0CVH9

Protein Details
Accession Q0CVH9   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
2-49VLAKKHVPIVKKRTKKFWRHQSDRFKCVPESWRKPKGIDNRVRRRFKSHydrophilic
NLS Segment(s)
PositionSequence
11-20VKKRTKKFWR
34-46RKPKGIDNRVRRR
Subcellular Location(s) mito 21.5, mito_nucl 12.333, cyto 3.5, cyto_nucl 3.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVLAKKHVPIVKKRTKKFWRHQSDRFKCVPESWRKPKGIDNRVRRRFKSNIPMPSIGYGSNKKTKHMMPSGHKAFLVHNPKDVELLLMHNRTYAAEIAHAVSSRKRVDILAKAKALGVKVTNPKGRVTTEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.82
3 0.86
4 0.87
5 0.87
6 0.88
7 0.87
8 0.91
9 0.91
10 0.89
11 0.86
12 0.79
13 0.72
14 0.62
15 0.58
16 0.57
17 0.57
18 0.58
19 0.6
20 0.64
21 0.63
22 0.63
23 0.66
24 0.67
25 0.67
26 0.66
27 0.68
28 0.7
29 0.78
30 0.83
31 0.78
32 0.74
33 0.69
34 0.68
35 0.68
36 0.64
37 0.62
38 0.6
39 0.59
40 0.52
41 0.48
42 0.4
43 0.3
44 0.26
45 0.21
46 0.2
47 0.26
48 0.25
49 0.25
50 0.28
51 0.29
52 0.32
53 0.35
54 0.38
55 0.37
56 0.46
57 0.48
58 0.45
59 0.43
60 0.37
61 0.33
62 0.34
63 0.37
64 0.27
65 0.29
66 0.29
67 0.29
68 0.29
69 0.27
70 0.2
71 0.12
72 0.15
73 0.15
74 0.15
75 0.15
76 0.15
77 0.15
78 0.14
79 0.15
80 0.12
81 0.08
82 0.08
83 0.09
84 0.1
85 0.11
86 0.11
87 0.11
88 0.12
89 0.17
90 0.18
91 0.18
92 0.18
93 0.19
94 0.24
95 0.33
96 0.37
97 0.39
98 0.39
99 0.39
100 0.39
101 0.39
102 0.34
103 0.28
104 0.23
105 0.24
106 0.31
107 0.39
108 0.43
109 0.43
110 0.45
111 0.46