Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0CE44

Protein Details
Accession Q0CE44    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
232-252RAKHEQFERRRRQHYEMRNIKBasic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito 10, cyto_nucl 10, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007062  PPI-2  
Gene Ontology GO:0004864  F:protein phosphatase inhibitor activity  
GO:0043666  P:regulation of phosphoprotein phosphatase activity  
GO:0009966  P:regulation of signal transduction  
Pfam View protein in Pfam  
PF04979  IPP-2  
Amino Acid Sequences MAHAMTDTHKRPKGILKNPSSSSSSIPRVTTANIAISPTGPTAADPLDTKELTLQNTLQNAGRRRSSSGAVSGRRQSLASAHGQHDENSPRLKWDEANLYLTEQEKTAKMKIDEPKTPYAPRYDPAEDEEEMRLAEEAEESLIDAQGVVVDELDRSTKGTGAAKKALAEEEIPDLELGEPEEALAGGAAGEAGERIVRARSLSNESGKGDRHVVVGEDGGDADHLLTPEEARAKHEQFERRRRQHYEMRNIKELLAHPENLDEMDEDEDEGEEETPAVPPPVPQIPQKFLNGEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.65
3 0.64
4 0.69
5 0.71
6 0.71
7 0.65
8 0.56
9 0.51
10 0.48
11 0.45
12 0.4
13 0.37
14 0.35
15 0.33
16 0.33
17 0.31
18 0.26
19 0.23
20 0.2
21 0.2
22 0.19
23 0.18
24 0.17
25 0.14
26 0.13
27 0.1
28 0.09
29 0.1
30 0.1
31 0.11
32 0.11
33 0.14
34 0.18
35 0.18
36 0.18
37 0.21
38 0.23
39 0.23
40 0.25
41 0.23
42 0.22
43 0.23
44 0.25
45 0.24
46 0.28
47 0.31
48 0.33
49 0.35
50 0.34
51 0.36
52 0.37
53 0.37
54 0.33
55 0.36
56 0.39
57 0.39
58 0.42
59 0.42
60 0.41
61 0.39
62 0.36
63 0.29
64 0.23
65 0.23
66 0.24
67 0.23
68 0.23
69 0.26
70 0.26
71 0.27
72 0.29
73 0.29
74 0.27
75 0.26
76 0.24
77 0.23
78 0.24
79 0.24
80 0.2
81 0.21
82 0.25
83 0.24
84 0.27
85 0.25
86 0.24
87 0.24
88 0.24
89 0.2
90 0.13
91 0.12
92 0.11
93 0.13
94 0.15
95 0.18
96 0.18
97 0.25
98 0.32
99 0.37
100 0.4
101 0.42
102 0.45
103 0.45
104 0.45
105 0.4
106 0.37
107 0.33
108 0.3
109 0.32
110 0.28
111 0.25
112 0.26
113 0.28
114 0.23
115 0.23
116 0.21
117 0.15
118 0.13
119 0.12
120 0.09
121 0.06
122 0.06
123 0.04
124 0.04
125 0.03
126 0.03
127 0.03
128 0.03
129 0.03
130 0.03
131 0.03
132 0.02
133 0.03
134 0.03
135 0.03
136 0.03
137 0.03
138 0.03
139 0.03
140 0.04
141 0.04
142 0.05
143 0.05
144 0.06
145 0.08
146 0.12
147 0.16
148 0.19
149 0.21
150 0.21
151 0.22
152 0.22
153 0.2
154 0.16
155 0.13
156 0.11
157 0.1
158 0.09
159 0.09
160 0.08
161 0.08
162 0.07
163 0.07
164 0.06
165 0.04
166 0.04
167 0.04
168 0.04
169 0.04
170 0.03
171 0.03
172 0.02
173 0.02
174 0.02
175 0.02
176 0.02
177 0.02
178 0.02
179 0.02
180 0.02
181 0.02
182 0.03
183 0.04
184 0.05
185 0.06
186 0.08
187 0.11
188 0.18
189 0.22
190 0.25
191 0.27
192 0.29
193 0.31
194 0.3
195 0.29
196 0.25
197 0.22
198 0.19
199 0.17
200 0.16
201 0.13
202 0.13
203 0.11
204 0.09
205 0.08
206 0.07
207 0.06
208 0.05
209 0.05
210 0.05
211 0.05
212 0.06
213 0.06
214 0.06
215 0.09
216 0.13
217 0.13
218 0.16
219 0.23
220 0.24
221 0.29
222 0.36
223 0.43
224 0.5
225 0.61
226 0.68
227 0.7
228 0.77
229 0.78
230 0.79
231 0.8
232 0.8
233 0.8
234 0.79
235 0.77
236 0.75
237 0.69
238 0.61
239 0.56
240 0.48
241 0.45
242 0.39
243 0.33
244 0.27
245 0.27
246 0.27
247 0.22
248 0.21
249 0.13
250 0.1
251 0.11
252 0.11
253 0.1
254 0.1
255 0.09
256 0.09
257 0.09
258 0.08
259 0.06
260 0.07
261 0.07
262 0.07
263 0.08
264 0.09
265 0.09
266 0.09
267 0.14
268 0.2
269 0.23
270 0.29
271 0.36
272 0.4
273 0.45
274 0.49