Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0D0J1

Protein Details
Accession Q0D0J1   
Localization Confidence High
Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
18-47KGSKVSDGRVEKKKKKSKKNKDGEAPPPTTBasic
NLS Segment(s)
PositionSequence
13-38GKLKLKGSKVSDGRVEKKKKKSKKNK
92-117EAERKHEEARRKRLQERLKREGVKTH
Subcellular Location(s) nucl 19.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MAPGDEYSVGGGGKLKLKGSKVSDGRVEKKKKKSKKNKDGEAPPPTTATSTSTPGEESAVSPAAADEKNDRTELEGSGSPAPAGEGGPAKTEAERKHEEARRKRLQERLKREGVKTHKERVEELNKYLSRLSEHHDMPKIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.2
3 0.23
4 0.25
5 0.32
6 0.35
7 0.42
8 0.41
9 0.44
10 0.49
11 0.53
12 0.59
13 0.62
14 0.67
15 0.66
16 0.74
17 0.79
18 0.81
19 0.85
20 0.88
21 0.9
22 0.91
23 0.93
24 0.92
25 0.92
26 0.91
27 0.89
28 0.85
29 0.76
30 0.66
31 0.56
32 0.47
33 0.37
34 0.29
35 0.23
36 0.17
37 0.17
38 0.17
39 0.16
40 0.16
41 0.15
42 0.15
43 0.12
44 0.1
45 0.09
46 0.09
47 0.08
48 0.08
49 0.07
50 0.09
51 0.08
52 0.09
53 0.09
54 0.11
55 0.13
56 0.13
57 0.13
58 0.13
59 0.14
60 0.13
61 0.13
62 0.12
63 0.12
64 0.12
65 0.12
66 0.1
67 0.09
68 0.09
69 0.06
70 0.06
71 0.05
72 0.06
73 0.07
74 0.08
75 0.09
76 0.09
77 0.1
78 0.15
79 0.16
80 0.21
81 0.25
82 0.27
83 0.36
84 0.41
85 0.5
86 0.55
87 0.64
88 0.67
89 0.7
90 0.72
91 0.72
92 0.77
93 0.77
94 0.77
95 0.76
96 0.75
97 0.74
98 0.7
99 0.7
100 0.69
101 0.69
102 0.65
103 0.66
104 0.6
105 0.57
106 0.58
107 0.58
108 0.59
109 0.53
110 0.5
111 0.5
112 0.47
113 0.47
114 0.45
115 0.37
116 0.31
117 0.29
118 0.32
119 0.3
120 0.33
121 0.38
122 0.42
123 0.42