Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0TXH9

Protein Details
Accession Q0TXH9   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MAKSKNSSQHNQSKKNHRNGIKKPKTHRYPSLHydrophilic
NLS Segment(s)
PositionSequence
14-61KKNHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGK
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
KEGG pno:SNOG_15733  -  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNSSQHNQSKKNHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.85
3 0.85
4 0.84
5 0.84
6 0.85
7 0.87
8 0.86
9 0.84
10 0.82
11 0.84
12 0.83
13 0.8
14 0.79
15 0.77
16 0.74
17 0.72
18 0.7
19 0.65
20 0.61
21 0.58
22 0.59
23 0.54
24 0.56
25 0.58
26 0.6
27 0.64
28 0.66
29 0.72
30 0.66
31 0.71
32 0.65
33 0.66
34 0.64
35 0.57
36 0.54
37 0.48
38 0.45
39 0.39
40 0.39
41 0.31
42 0.31
43 0.36
44 0.4
45 0.45