Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0CVQ1

Protein Details
Accession Q0CVQ1    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
275-300SWEEYKEERRRAKEQRRHQRETDGRGBasic
NLS Segment(s)
PositionSequence
284-290RRAKEQR
Subcellular Location(s) cyto 13, mito 9, cyto_nucl 9, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019560  Mitochondrial_18_kDa_protein  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF10558  MTP18  
Amino Acid Sequences MAENPPTNPSSSVDSTETPYRYAGYANRLRTILLSAHRYVAYTSDIGESFRPVAHPYLVRSAYAISWSYLIGDVVHEGYKAYLRNRRVLAPPCDAYKDASNVALGMVTGNLSGPLTSASPAASSAVTTDKDTLTPWPTTRIPLAEDYRMVMAKRAVFQSVASMGLPALTIHSVVKYSGRMLKNSKMVFFRTWAPIGLGLSVVPFLPYIFDEPVEEAVEWVFRTGLRAYAGEDAVRPLPQPAHAADEDATSLSHLLHVQREQGHPADATATSATLSWEEYKEERRRAKEQRRHQRETDGRGGILAMLGLEKKKNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.33
3 0.38
4 0.36
5 0.31
6 0.29
7 0.26
8 0.23
9 0.25
10 0.24
11 0.28
12 0.34
13 0.36
14 0.39
15 0.38
16 0.38
17 0.35
18 0.34
19 0.29
20 0.27
21 0.29
22 0.27
23 0.3
24 0.29
25 0.29
26 0.26
27 0.23
28 0.2
29 0.15
30 0.15
31 0.14
32 0.14
33 0.15
34 0.15
35 0.15
36 0.13
37 0.14
38 0.14
39 0.13
40 0.15
41 0.18
42 0.2
43 0.21
44 0.28
45 0.28
46 0.27
47 0.26
48 0.24
49 0.21
50 0.21
51 0.19
52 0.11
53 0.11
54 0.11
55 0.11
56 0.1
57 0.1
58 0.07
59 0.07
60 0.07
61 0.08
62 0.08
63 0.07
64 0.07
65 0.07
66 0.1
67 0.13
68 0.17
69 0.23
70 0.26
71 0.33
72 0.35
73 0.39
74 0.44
75 0.49
76 0.49
77 0.48
78 0.47
79 0.43
80 0.44
81 0.4
82 0.35
83 0.3
84 0.26
85 0.21
86 0.19
87 0.17
88 0.14
89 0.13
90 0.1
91 0.07
92 0.05
93 0.04
94 0.04
95 0.03
96 0.03
97 0.03
98 0.03
99 0.03
100 0.03
101 0.04
102 0.05
103 0.05
104 0.05
105 0.05
106 0.06
107 0.06
108 0.07
109 0.06
110 0.05
111 0.06
112 0.08
113 0.09
114 0.09
115 0.1
116 0.1
117 0.1
118 0.11
119 0.13
120 0.13
121 0.14
122 0.14
123 0.18
124 0.18
125 0.2
126 0.2
127 0.18
128 0.17
129 0.2
130 0.22
131 0.19
132 0.18
133 0.17
134 0.17
135 0.17
136 0.15
137 0.11
138 0.11
139 0.11
140 0.13
141 0.13
142 0.12
143 0.11
144 0.11
145 0.11
146 0.1
147 0.09
148 0.07
149 0.07
150 0.06
151 0.06
152 0.06
153 0.04
154 0.04
155 0.03
156 0.04
157 0.04
158 0.05
159 0.05
160 0.05
161 0.06
162 0.06
163 0.08
164 0.15
165 0.17
166 0.2
167 0.23
168 0.28
169 0.34
170 0.35
171 0.36
172 0.31
173 0.33
174 0.31
175 0.29
176 0.27
177 0.24
178 0.24
179 0.21
180 0.19
181 0.17
182 0.16
183 0.14
184 0.1
185 0.07
186 0.06
187 0.06
188 0.05
189 0.04
190 0.04
191 0.04
192 0.04
193 0.05
194 0.07
195 0.08
196 0.08
197 0.08
198 0.09
199 0.11
200 0.11
201 0.1
202 0.08
203 0.08
204 0.08
205 0.08
206 0.07
207 0.06
208 0.05
209 0.07
210 0.08
211 0.1
212 0.11
213 0.11
214 0.12
215 0.15
216 0.16
217 0.14
218 0.14
219 0.14
220 0.13
221 0.13
222 0.12
223 0.1
224 0.11
225 0.12
226 0.14
227 0.13
228 0.18
229 0.18
230 0.19
231 0.18
232 0.18
233 0.16
234 0.14
235 0.13
236 0.08
237 0.08
238 0.06
239 0.07
240 0.08
241 0.1
242 0.13
243 0.14
244 0.19
245 0.23
246 0.25
247 0.27
248 0.27
249 0.27
250 0.23
251 0.23
252 0.2
253 0.16
254 0.16
255 0.12
256 0.11
257 0.09
258 0.09
259 0.1
260 0.08
261 0.1
262 0.11
263 0.12
264 0.15
265 0.18
266 0.28
267 0.35
268 0.44
269 0.5
270 0.54
271 0.63
272 0.71
273 0.79
274 0.8
275 0.83
276 0.86
277 0.88
278 0.89
279 0.83
280 0.83
281 0.81
282 0.79
283 0.77
284 0.69
285 0.58
286 0.51
287 0.46
288 0.35
289 0.26
290 0.18
291 0.08
292 0.07
293 0.09
294 0.11