Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q0CES5

Protein Details
Accession Q0CES5    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
246-268TPSSIFSRRRTKRPSSPPRDILSHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 11, cyto 7, nucl 4, cyto_mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007783  eIF3d  
Gene Ontology GO:0005829  C:cytosol  
GO:0016282  C:eukaryotic 43S preinitiation complex  
GO:0071540  C:eukaryotic translation initiation factor 3 complex, eIF3e  
GO:0071541  C:eukaryotic translation initiation factor 3 complex, eIF3m  
GO:0003723  F:RNA binding  
GO:0003743  F:translation initiation factor activity  
Pfam View protein in Pfam  
PF05091  eIF-3_zeta  
Amino Acid Sequences MAPLSIADLVAALPAEDTWGPATSGDNMLNGVPYAPFSKGDKLGRMADWTAESKDRDRAGRQAYNRNYRDQQVYGAGSSSLFSIQAAEEESSFSVVDNTRTSAKRTFGRGGGTVFRGRGQRGGAQRGGRAGFQRVGAGRGQGDRYYDNRSGRSNRGRRFGWKDYDKPQRTREPSVNVRPDWTMLEEVDFSRLSKLNLETPDGEDLDSYGFLYYYDRSYDKAPVKNAERRLQALDRGSPTTSPPPRTPSSIFSRRRTKRPSSPPRDILSMLMCATRSVYSWDIVIVHQGNKIYFDKREGASLDMGTVNENAADAPLELAETSGKQESINTPSALAMEATFINHNFALHTVTESESAKLEMSHPNPFYNASRGDRASRVQAYKYRRFLPVSWSGTRKPSHGRPDGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.07
3 0.07
4 0.08
5 0.09
6 0.1
7 0.11
8 0.11
9 0.13
10 0.13
11 0.17
12 0.16
13 0.15
14 0.15
15 0.14
16 0.15
17 0.13
18 0.11
19 0.08
20 0.09
21 0.11
22 0.11
23 0.14
24 0.16
25 0.22
26 0.29
27 0.33
28 0.36
29 0.38
30 0.41
31 0.4
32 0.41
33 0.36
34 0.31
35 0.3
36 0.28
37 0.27
38 0.27
39 0.28
40 0.27
41 0.33
42 0.35
43 0.36
44 0.37
45 0.42
46 0.46
47 0.51
48 0.55
49 0.59
50 0.64
51 0.7
52 0.69
53 0.69
54 0.64
55 0.61
56 0.6
57 0.51
58 0.44
59 0.39
60 0.37
61 0.3
62 0.27
63 0.22
64 0.17
65 0.16
66 0.13
67 0.08
68 0.07
69 0.06
70 0.06
71 0.06
72 0.07
73 0.08
74 0.08
75 0.08
76 0.09
77 0.09
78 0.09
79 0.09
80 0.08
81 0.09
82 0.1
83 0.12
84 0.12
85 0.14
86 0.19
87 0.2
88 0.24
89 0.26
90 0.3
91 0.33
92 0.38
93 0.4
94 0.37
95 0.39
96 0.38
97 0.36
98 0.35
99 0.33
100 0.29
101 0.25
102 0.26
103 0.25
104 0.24
105 0.24
106 0.22
107 0.25
108 0.29
109 0.34
110 0.35
111 0.34
112 0.35
113 0.35
114 0.34
115 0.3
116 0.26
117 0.23
118 0.21
119 0.19
120 0.21
121 0.18
122 0.19
123 0.17
124 0.16
125 0.15
126 0.15
127 0.16
128 0.14
129 0.15
130 0.16
131 0.18
132 0.23
133 0.27
134 0.28
135 0.28
136 0.33
137 0.36
138 0.42
139 0.51
140 0.53
141 0.53
142 0.57
143 0.57
144 0.6
145 0.63
146 0.62
147 0.6
148 0.59
149 0.59
150 0.6
151 0.69
152 0.68
153 0.65
154 0.64
155 0.64
156 0.63
157 0.64
158 0.6
159 0.57
160 0.59
161 0.63
162 0.63
163 0.53
164 0.5
165 0.44
166 0.39
167 0.32
168 0.25
169 0.17
170 0.11
171 0.11
172 0.1
173 0.1
174 0.11
175 0.1
176 0.08
177 0.09
178 0.1
179 0.1
180 0.12
181 0.13
182 0.16
183 0.17
184 0.18
185 0.17
186 0.18
187 0.19
188 0.16
189 0.15
190 0.1
191 0.09
192 0.08
193 0.07
194 0.06
195 0.04
196 0.04
197 0.04
198 0.05
199 0.05
200 0.06
201 0.08
202 0.08
203 0.1
204 0.11
205 0.18
206 0.23
207 0.26
208 0.28
209 0.32
210 0.38
211 0.43
212 0.48
213 0.47
214 0.43
215 0.41
216 0.44
217 0.4
218 0.38
219 0.34
220 0.31
221 0.27
222 0.26
223 0.25
224 0.21
225 0.21
226 0.26
227 0.28
228 0.29
229 0.29
230 0.34
231 0.35
232 0.39
233 0.4
234 0.36
235 0.41
236 0.47
237 0.52
238 0.53
239 0.62
240 0.64
241 0.7
242 0.73
243 0.73
244 0.73
245 0.77
246 0.81
247 0.79
248 0.83
249 0.8
250 0.75
251 0.7
252 0.6
253 0.5
254 0.41
255 0.33
256 0.24
257 0.18
258 0.15
259 0.11
260 0.12
261 0.1
262 0.09
263 0.11
264 0.12
265 0.11
266 0.11
267 0.12
268 0.12
269 0.11
270 0.15
271 0.13
272 0.13
273 0.14
274 0.15
275 0.15
276 0.18
277 0.2
278 0.19
279 0.19
280 0.22
281 0.25
282 0.24
283 0.27
284 0.25
285 0.24
286 0.23
287 0.22
288 0.2
289 0.16
290 0.15
291 0.13
292 0.11
293 0.09
294 0.07
295 0.07
296 0.06
297 0.05
298 0.05
299 0.04
300 0.04
301 0.04
302 0.05
303 0.04
304 0.05
305 0.05
306 0.05
307 0.08
308 0.09
309 0.09
310 0.09
311 0.12
312 0.15
313 0.2
314 0.24
315 0.22
316 0.21
317 0.21
318 0.21
319 0.19
320 0.16
321 0.1
322 0.08
323 0.08
324 0.09
325 0.1
326 0.1
327 0.12
328 0.12
329 0.12
330 0.11
331 0.11
332 0.12
333 0.11
334 0.12
335 0.11
336 0.13
337 0.16
338 0.16
339 0.16
340 0.15
341 0.15
342 0.14
343 0.13
344 0.15
345 0.2
346 0.22
347 0.29
348 0.3
349 0.31
350 0.32
351 0.35
352 0.35
353 0.33
354 0.36
355 0.33
356 0.37
357 0.38
358 0.42
359 0.42
360 0.42
361 0.45
362 0.46
363 0.45
364 0.46
365 0.51
366 0.55
367 0.61
368 0.65
369 0.62
370 0.6
371 0.61
372 0.57
373 0.58
374 0.59
375 0.56
376 0.55
377 0.56
378 0.54
379 0.56
380 0.56
381 0.54
382 0.53
383 0.55
384 0.59