Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0UIT3

Protein Details
Accession Q0UIT3    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
107-126TTAHAARGRHRRDRDMRCGWBasic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 3, cyto 3, extr 3, cyto_mito 3
Family & Domain DBs
KEGG pno:SNOG_08331  -  
Amino Acid Sequences MVKVLQLEELPGPNAGDIRPAWRDGSRSRAATLETLAGNVPVDAHAGATLHHQLQSLTLARILTVPIRHTRSLATTPAPPTQSPPPLLLSSATRPRPAAPDYFGTTTTAHAARGRHRRDRDMRCGWEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.12
4 0.11
5 0.15
6 0.16
7 0.18
8 0.2
9 0.21
10 0.26
11 0.26
12 0.33
13 0.34
14 0.34
15 0.33
16 0.32
17 0.32
18 0.28
19 0.26
20 0.21
21 0.15
22 0.14
23 0.13
24 0.11
25 0.1
26 0.08
27 0.07
28 0.05
29 0.05
30 0.04
31 0.04
32 0.04
33 0.04
34 0.05
35 0.06
36 0.08
37 0.08
38 0.08
39 0.09
40 0.08
41 0.09
42 0.11
43 0.11
44 0.1
45 0.1
46 0.09
47 0.09
48 0.09
49 0.09
50 0.08
51 0.08
52 0.1
53 0.14
54 0.17
55 0.18
56 0.18
57 0.18
58 0.2
59 0.22
60 0.22
61 0.19
62 0.19
63 0.22
64 0.25
65 0.25
66 0.22
67 0.23
68 0.26
69 0.28
70 0.27
71 0.26
72 0.26
73 0.24
74 0.25
75 0.22
76 0.2
77 0.22
78 0.29
79 0.29
80 0.28
81 0.28
82 0.29
83 0.32
84 0.32
85 0.29
86 0.25
87 0.27
88 0.3
89 0.31
90 0.3
91 0.28
92 0.26
93 0.23
94 0.24
95 0.19
96 0.17
97 0.18
98 0.21
99 0.28
100 0.38
101 0.45
102 0.51
103 0.57
104 0.65
105 0.73
106 0.79
107 0.8
108 0.8