Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0U1C4

Protein Details
Accession Q0U1C4   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
113-132DPSRKRSKVSRACDECRRKKBasic
NLS Segment(s)
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
KEGG pno:SNOG_14313  -  
CDD cd00067  GAL4  
Amino Acid Sequences MSSNYPDPNAQMSGAPGAYVNHNEAQPTQQQQQHMSDPELRLQENLQQLREGGDMMHSGNQQQPQYQQLAQMPPSMGAHQHFQSPARPTHSPQQMAHAVMSLEGQHDAYDPNDPSRKRSKVSRACDECRRKKVRNAPSVLAQSANKNRYGVMRQARMDQNLAPVVREQERDVNLVDNP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.12
4 0.12
5 0.13
6 0.14
7 0.16
8 0.16
9 0.17
10 0.18
11 0.18
12 0.2
13 0.23
14 0.27
15 0.29
16 0.3
17 0.32
18 0.35
19 0.39
20 0.41
21 0.38
22 0.36
23 0.35
24 0.33
25 0.35
26 0.33
27 0.29
28 0.25
29 0.23
30 0.25
31 0.28
32 0.29
33 0.25
34 0.23
35 0.23
36 0.24
37 0.23
38 0.18
39 0.1
40 0.08
41 0.08
42 0.08
43 0.11
44 0.09
45 0.1
46 0.13
47 0.17
48 0.16
49 0.17
50 0.18
51 0.18
52 0.21
53 0.21
54 0.2
55 0.2
56 0.22
57 0.21
58 0.22
59 0.19
60 0.17
61 0.17
62 0.14
63 0.12
64 0.11
65 0.12
66 0.11
67 0.12
68 0.12
69 0.13
70 0.17
71 0.19
72 0.2
73 0.22
74 0.23
75 0.24
76 0.32
77 0.36
78 0.36
79 0.33
80 0.36
81 0.33
82 0.33
83 0.3
84 0.23
85 0.17
86 0.13
87 0.13
88 0.08
89 0.06
90 0.05
91 0.05
92 0.04
93 0.05
94 0.05
95 0.06
96 0.09
97 0.09
98 0.13
99 0.19
100 0.19
101 0.24
102 0.33
103 0.36
104 0.36
105 0.44
106 0.51
107 0.55
108 0.63
109 0.69
110 0.68
111 0.71
112 0.78
113 0.8
114 0.78
115 0.79
116 0.79
117 0.74
118 0.75
119 0.79
120 0.79
121 0.78
122 0.75
123 0.68
124 0.67
125 0.66
126 0.57
127 0.5
128 0.41
129 0.39
130 0.41
131 0.4
132 0.34
133 0.3
134 0.3
135 0.33
136 0.36
137 0.37
138 0.38
139 0.43
140 0.43
141 0.5
142 0.54
143 0.51
144 0.49
145 0.42
146 0.37
147 0.35
148 0.34
149 0.27
150 0.24
151 0.26
152 0.28
153 0.28
154 0.27
155 0.29
156 0.3
157 0.31
158 0.31