Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0U160

Protein Details
Accession Q0U160   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MVSNRLSKVTKQIRKKKGKNPNLHEGSRHydrophilic
NLS Segment(s)
PositionSequence
13-19IRKKKGK
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR021346  Tma16  
IPR038356  Tma16_sf  
Gene Ontology GO:0005634  C:nucleus  
KEGG pno:SNOG_14576  -  
Pfam View protein in Pfam  
PF11176  Tma16  
Amino Acid Sequences MVSNRLSKVTKQIRKKKGKNPNLHEGSRDTQRLQSAAARDDKLNRLTSLREKQNRHYCKAMIEDYLGRDDEEVLKLKAERRAGRASTASGFWVPDLENLENLKKLKEWNGQWAGLATLKFARISREGVKKESSFPPKGLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.9
3 0.89
4 0.9
5 0.91
6 0.91
7 0.89
8 0.89
9 0.85
10 0.77
11 0.69
12 0.64
13 0.58
14 0.53
15 0.48
16 0.38
17 0.34
18 0.34
19 0.31
20 0.28
21 0.27
22 0.23
23 0.25
24 0.28
25 0.26
26 0.25
27 0.29
28 0.32
29 0.31
30 0.31
31 0.27
32 0.24
33 0.26
34 0.33
35 0.38
36 0.43
37 0.47
38 0.49
39 0.58
40 0.67
41 0.68
42 0.64
43 0.6
44 0.51
45 0.46
46 0.47
47 0.39
48 0.29
49 0.25
50 0.22
51 0.19
52 0.19
53 0.16
54 0.11
55 0.1
56 0.09
57 0.08
58 0.09
59 0.09
60 0.08
61 0.09
62 0.1
63 0.13
64 0.16
65 0.21
66 0.22
67 0.26
68 0.31
69 0.31
70 0.33
71 0.32
72 0.29
73 0.25
74 0.23
75 0.19
76 0.14
77 0.13
78 0.1
79 0.1
80 0.08
81 0.09
82 0.12
83 0.12
84 0.13
85 0.15
86 0.16
87 0.19
88 0.19
89 0.18
90 0.16
91 0.18
92 0.24
93 0.3
94 0.32
95 0.38
96 0.43
97 0.42
98 0.41
99 0.39
100 0.32
101 0.27
102 0.24
103 0.15
104 0.12
105 0.13
106 0.14
107 0.14
108 0.17
109 0.17
110 0.23
111 0.29
112 0.38
113 0.4
114 0.43
115 0.49
116 0.46
117 0.5
118 0.54
119 0.55
120 0.49