Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0C9M9

Protein Details
Accession Q0C9M9   
Localization Confidence High
Confidence Score 20.5
NoLS Segment(s)
PositionSequenceProtein Nature
16-61TGDRNYRDRSDRPKRKDRDVSEDAPHHAYRKKIKIPKKEHPYPSVNBasic
263-289QSKTDQTKSKSKKSEYKDTKHATKGKGHydrophilic
NLS Segment(s)
PositionSequence
27-33RPKRKDR
40-58PHHAYRKKIKIPKKEHPYP
63-67LKKRI
Subcellular Location(s) nucl 23.5, cyto_nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019310  Efg1  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF10153  Efg1  
Amino Acid Sequences MPRDYSRSQSPVSNPTGDRNYRDRSDRPKRKDRDVSEDAPHHAYRKKIKIPKKEHPYPSVNELKKRIRDVKRLLNRVDLPADARIVQERALAGYENDLEEEMQRRHRSAMIKKYHFVRFLDRKTATKDVKRLERREQEVSKSDLDAVAKEKKLAALSQKLDIARVNLNYTIYYPLTEKYIALYAAVKKNKDGTTDGAADDSDVDAGYKLVHATREEKPAMWHVVEKCMKDGTLELLREGKLDTPDVDSTGKGSQKSKIDKHAQSKTDQTKSKSKKSEYKDTKHATKGKGRSVTSAASDENGDESDGGFFEM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.48
3 0.54
4 0.52
5 0.52
6 0.51
7 0.53
8 0.52
9 0.58
10 0.58
11 0.6
12 0.68
13 0.73
14 0.76
15 0.8
16 0.81
17 0.85
18 0.88
19 0.84
20 0.82
21 0.79
22 0.75
23 0.72
24 0.69
25 0.61
26 0.56
27 0.5
28 0.44
29 0.4
30 0.41
31 0.43
32 0.48
33 0.55
34 0.59
35 0.68
36 0.74
37 0.81
38 0.84
39 0.86
40 0.86
41 0.84
42 0.82
43 0.79
44 0.72
45 0.71
46 0.7
47 0.64
48 0.61
49 0.61
50 0.61
51 0.61
52 0.65
53 0.67
54 0.65
55 0.7
56 0.72
57 0.75
58 0.77
59 0.79
60 0.73
61 0.71
62 0.64
63 0.57
64 0.51
65 0.4
66 0.32
67 0.26
68 0.25
69 0.17
70 0.16
71 0.14
72 0.13
73 0.13
74 0.12
75 0.11
76 0.1
77 0.1
78 0.1
79 0.08
80 0.09
81 0.09
82 0.08
83 0.08
84 0.07
85 0.07
86 0.08
87 0.12
88 0.12
89 0.18
90 0.19
91 0.2
92 0.21
93 0.26
94 0.32
95 0.37
96 0.45
97 0.48
98 0.51
99 0.53
100 0.58
101 0.59
102 0.54
103 0.47
104 0.47
105 0.46
106 0.46
107 0.51
108 0.47
109 0.45
110 0.47
111 0.53
112 0.49
113 0.46
114 0.48
115 0.46
116 0.54
117 0.6
118 0.6
119 0.61
120 0.63
121 0.63
122 0.65
123 0.61
124 0.56
125 0.51
126 0.49
127 0.4
128 0.32
129 0.28
130 0.21
131 0.18
132 0.14
133 0.14
134 0.15
135 0.15
136 0.15
137 0.15
138 0.14
139 0.15
140 0.16
141 0.17
142 0.18
143 0.19
144 0.21
145 0.23
146 0.22
147 0.22
148 0.21
149 0.18
150 0.14
151 0.14
152 0.13
153 0.12
154 0.12
155 0.11
156 0.12
157 0.12
158 0.1
159 0.1
160 0.1
161 0.09
162 0.11
163 0.11
164 0.1
165 0.09
166 0.1
167 0.09
168 0.09
169 0.11
170 0.13
171 0.2
172 0.23
173 0.22
174 0.22
175 0.28
176 0.28
177 0.29
178 0.27
179 0.23
180 0.25
181 0.26
182 0.26
183 0.2
184 0.18
185 0.16
186 0.14
187 0.1
188 0.06
189 0.04
190 0.04
191 0.04
192 0.04
193 0.04
194 0.04
195 0.05
196 0.06
197 0.07
198 0.09
199 0.14
200 0.18
201 0.24
202 0.25
203 0.25
204 0.26
205 0.29
206 0.3
207 0.26
208 0.28
209 0.22
210 0.31
211 0.34
212 0.32
213 0.3
214 0.28
215 0.27
216 0.22
217 0.22
218 0.18
219 0.2
220 0.2
221 0.19
222 0.21
223 0.21
224 0.21
225 0.21
226 0.18
227 0.14
228 0.15
229 0.15
230 0.16
231 0.17
232 0.18
233 0.19
234 0.15
235 0.16
236 0.2
237 0.22
238 0.2
239 0.22
240 0.26
241 0.33
242 0.42
243 0.46
244 0.51
245 0.58
246 0.63
247 0.71
248 0.74
249 0.69
250 0.65
251 0.69
252 0.69
253 0.68
254 0.66
255 0.62
256 0.64
257 0.69
258 0.75
259 0.74
260 0.74
261 0.74
262 0.76
263 0.82
264 0.81
265 0.81
266 0.82
267 0.81
268 0.81
269 0.81
270 0.8
271 0.77
272 0.76
273 0.75
274 0.74
275 0.73
276 0.67
277 0.63
278 0.59
279 0.55
280 0.48
281 0.44
282 0.35
283 0.28
284 0.27
285 0.22
286 0.19
287 0.16
288 0.13
289 0.1
290 0.1
291 0.1