Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0CJY3

Protein Details
Accession Q0CJY3   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
106-127AGRRTSPRATLRPKPHHKTLIFHydrophilic
NLS Segment(s)
PositionSequence
105-122GAGRRTSPRATLRPKPHH
Subcellular Location(s) nucl 13, cyto_nucl 11, cyto 7, mito 3, extr 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039723  Vps71/ZNHIT1  
Gene Ontology GO:0006338  P:chromatin remodeling  
Amino Acid Sequences MYHVELLPSGSSHATPGWTYVADRGFDPAKAAITPAIGRKRGIRDPGRADLSSRQNNAIVRHLAELDRENHRDVQIPIPAKQKDAAGRVPEDVPQLPRRRGGCPGAGRRTSPRATLRPKPHHKTLIFRLLPPTRRNP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.13
4 0.13
5 0.13
6 0.13
7 0.16
8 0.18
9 0.17
10 0.17
11 0.19
12 0.18
13 0.18
14 0.19
15 0.16
16 0.14
17 0.13
18 0.14
19 0.11
20 0.11
21 0.13
22 0.18
23 0.22
24 0.23
25 0.24
26 0.28
27 0.34
28 0.37
29 0.45
30 0.43
31 0.45
32 0.5
33 0.55
34 0.54
35 0.48
36 0.45
37 0.43
38 0.46
39 0.43
40 0.39
41 0.34
42 0.32
43 0.34
44 0.34
45 0.31
46 0.23
47 0.19
48 0.18
49 0.18
50 0.15
51 0.14
52 0.15
53 0.13
54 0.17
55 0.17
56 0.18
57 0.18
58 0.18
59 0.2
60 0.19
61 0.2
62 0.2
63 0.21
64 0.23
65 0.29
66 0.29
67 0.26
68 0.26
69 0.26
70 0.25
71 0.27
72 0.28
73 0.23
74 0.24
75 0.25
76 0.25
77 0.23
78 0.22
79 0.2
80 0.2
81 0.25
82 0.29
83 0.3
84 0.35
85 0.36
86 0.36
87 0.4
88 0.4
89 0.41
90 0.44
91 0.51
92 0.54
93 0.54
94 0.54
95 0.54
96 0.57
97 0.51
98 0.49
99 0.48
100 0.49
101 0.55
102 0.62
103 0.67
104 0.71
105 0.8
106 0.8
107 0.82
108 0.82
109 0.78
110 0.78
111 0.76
112 0.76
113 0.67
114 0.62
115 0.62
116 0.61
117 0.64