Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0UWK4

Protein Details
Accession Q0UWK4    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
66-89PSSTSAVKPKACKKRRRKRSQGMIHydrophilic
NLS Segment(s)
PositionSequence
73-85KPKACKKRRRKRS
Subcellular Location(s) nucl 11.5, mito 11, cyto_nucl 8, cyto 3.5
Family & Domain DBs
KEGG pno:SNOG_03860  -  
Amino Acid Sequences MLVQQSLRLHVEVCLLPLQVCFIYKHGFIAEFSNTNSIARIQPTKHVAKTSVVLSSSAADVPAPAPSSTSAVKPKACKKRRRKRSQGMI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.14
4 0.14
5 0.14
6 0.11
7 0.12
8 0.11
9 0.11
10 0.14
11 0.14
12 0.15
13 0.14
14 0.14
15 0.13
16 0.15
17 0.15
18 0.13
19 0.14
20 0.14
21 0.14
22 0.13
23 0.13
24 0.11
25 0.1
26 0.12
27 0.14
28 0.13
29 0.17
30 0.23
31 0.26
32 0.25
33 0.26
34 0.25
35 0.23
36 0.25
37 0.21
38 0.18
39 0.15
40 0.14
41 0.13
42 0.12
43 0.11
44 0.09
45 0.08
46 0.06
47 0.06
48 0.06
49 0.07
50 0.08
51 0.07
52 0.08
53 0.09
54 0.12
55 0.13
56 0.18
57 0.22
58 0.25
59 0.3
60 0.37
61 0.46
62 0.55
63 0.63
64 0.69
65 0.75
66 0.82
67 0.88
68 0.92
69 0.94