Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0CPQ3

Protein Details
Accession Q0CPQ3    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
187-217SIRGMSRAERKERIKRNERKMRANERKARKPBasic
NLS Segment(s)
PositionSequence
104-140PTPKPPTKWELFARKKGIGKYNTRPGAALADKERRKK
184-217KGSSIRGMSRAERKERIKRNERKMRANERKARKP
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 5.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MSEVETTNAAAGASKPKPERLPITVSKPTPYTFDLGHLLANDPNPLEISRSEPVNASLRSTARDGAQALLNQLLTTCPITTSQQGVLLTLPTPTTALPRHKPLPTPKPPTKWELFARKKGIGKYNTRPGAALADKERRKKLVYDEEKGEWVPRWGYKGKNKSDDDWLVEVNEKDWKKEEEAAAKGSSIRGMSRAERKERIKRNERKMRANERKARKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.26
3 0.32
4 0.36
5 0.42
6 0.47
7 0.44
8 0.5
9 0.5
10 0.57
11 0.58
12 0.56
13 0.53
14 0.49
15 0.45
16 0.4
17 0.35
18 0.3
19 0.22
20 0.24
21 0.24
22 0.22
23 0.22
24 0.18
25 0.18
26 0.17
27 0.17
28 0.14
29 0.11
30 0.11
31 0.11
32 0.11
33 0.11
34 0.1
35 0.15
36 0.16
37 0.17
38 0.17
39 0.17
40 0.19
41 0.24
42 0.23
43 0.2
44 0.22
45 0.22
46 0.23
47 0.24
48 0.22
49 0.17
50 0.19
51 0.17
52 0.15
53 0.17
54 0.15
55 0.15
56 0.14
57 0.13
58 0.11
59 0.1
60 0.08
61 0.07
62 0.07
63 0.07
64 0.06
65 0.08
66 0.1
67 0.11
68 0.13
69 0.12
70 0.15
71 0.14
72 0.14
73 0.13
74 0.12
75 0.11
76 0.09
77 0.08
78 0.05
79 0.06
80 0.05
81 0.08
82 0.12
83 0.18
84 0.2
85 0.26
86 0.3
87 0.31
88 0.37
89 0.42
90 0.48
91 0.52
92 0.58
93 0.59
94 0.61
95 0.62
96 0.62
97 0.55
98 0.51
99 0.48
100 0.5
101 0.5
102 0.51
103 0.53
104 0.51
105 0.53
106 0.51
107 0.52
108 0.48
109 0.49
110 0.49
111 0.55
112 0.53
113 0.5
114 0.46
115 0.39
116 0.38
117 0.31
118 0.27
119 0.22
120 0.28
121 0.33
122 0.38
123 0.4
124 0.37
125 0.38
126 0.38
127 0.42
128 0.44
129 0.47
130 0.47
131 0.49
132 0.48
133 0.47
134 0.44
135 0.37
136 0.27
137 0.21
138 0.18
139 0.15
140 0.19
141 0.21
142 0.29
143 0.37
144 0.45
145 0.51
146 0.58
147 0.6
148 0.58
149 0.62
150 0.58
151 0.53
152 0.46
153 0.39
154 0.3
155 0.3
156 0.27
157 0.2
158 0.24
159 0.2
160 0.19
161 0.22
162 0.24
163 0.25
164 0.3
165 0.34
166 0.34
167 0.37
168 0.38
169 0.35
170 0.33
171 0.31
172 0.26
173 0.22
174 0.16
175 0.14
176 0.13
177 0.16
178 0.22
179 0.31
180 0.38
181 0.44
182 0.51
183 0.6
184 0.67
185 0.74
186 0.79
187 0.8
188 0.83
189 0.87
190 0.89
191 0.89
192 0.9
193 0.9
194 0.91
195 0.91
196 0.92
197 0.9