Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0UJZ3

Protein Details
Accession Q0UJZ3   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
68-95DGPVSAKKPRKVKERQKKEDKARQEGCTBasic
NLS Segment(s)
PositionSequence
73-88AKKPRKVKERQKKEDK
Subcellular Location(s) mito 16, cyto_mito 11.166, mito_nucl 11.166, cyto_nucl 5.666, nucl 5, cyto 5
Family & Domain DBs
KEGG pno:SNOG_07921  -  
Amino Acid Sequences MAPKSCTLCDTTRPVLVRCQIDESAKWHFVCPGACWKSVSGGVEDAKGLEGQFPWYRYGGMWKDRSADGPVSAKKPRKVKERQKKEDKARQEGCTVENGEEASEEEIVGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.41
3 0.44
4 0.41
5 0.36
6 0.37
7 0.34
8 0.34
9 0.34
10 0.31
11 0.31
12 0.32
13 0.3
14 0.26
15 0.25
16 0.25
17 0.24
18 0.23
19 0.27
20 0.26
21 0.26
22 0.27
23 0.26
24 0.26
25 0.26
26 0.25
27 0.15
28 0.15
29 0.14
30 0.14
31 0.13
32 0.11
33 0.09
34 0.09
35 0.07
36 0.06
37 0.05
38 0.08
39 0.1
40 0.11
41 0.12
42 0.12
43 0.12
44 0.11
45 0.18
46 0.19
47 0.23
48 0.25
49 0.24
50 0.26
51 0.26
52 0.28
53 0.24
54 0.21
55 0.17
56 0.2
57 0.22
58 0.24
59 0.31
60 0.35
61 0.38
62 0.46
63 0.51
64 0.56
65 0.65
66 0.72
67 0.77
68 0.82
69 0.87
70 0.9
71 0.93
72 0.93
73 0.92
74 0.89
75 0.89
76 0.84
77 0.76
78 0.68
79 0.6
80 0.51
81 0.47
82 0.4
83 0.3
84 0.24
85 0.21
86 0.18
87 0.16
88 0.16
89 0.12
90 0.1