Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0D1E1

Protein Details
Accession Q0D1E1   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
98-124KHEATLKTERKRKQQIHFPQRKYAVKAHydrophilic
NLS Segment(s)
PositionSequence
86-111PKLTRALRRRLTKHEATLKTERKRKQ
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSSKVKAGQLWGKSKDDLTKQLEELKLELNQLRVQKIAGGASSKTLRIHDVRKSIARVLTVINANQRSQLRLFYKNKKYLPLDLRPKLTRALRRRLTKHEATLKTERKRKQQIHFPQRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.47
3 0.45
4 0.45
5 0.43
6 0.42
7 0.4
8 0.45
9 0.44
10 0.38
11 0.34
12 0.29
13 0.25
14 0.23
15 0.23
16 0.19
17 0.21
18 0.22
19 0.22
20 0.2
21 0.18
22 0.17
23 0.17
24 0.15
25 0.13
26 0.12
27 0.11
28 0.14
29 0.15
30 0.15
31 0.14
32 0.14
33 0.16
34 0.18
35 0.23
36 0.25
37 0.29
38 0.31
39 0.33
40 0.34
41 0.33
42 0.31
43 0.27
44 0.22
45 0.18
46 0.18
47 0.15
48 0.14
49 0.16
50 0.16
51 0.15
52 0.19
53 0.18
54 0.17
55 0.17
56 0.22
57 0.22
58 0.3
59 0.37
60 0.43
61 0.51
62 0.57
63 0.58
64 0.59
65 0.59
66 0.58
67 0.59
68 0.58
69 0.6
70 0.56
71 0.61
72 0.56
73 0.54
74 0.52
75 0.51
76 0.51
77 0.49
78 0.55
79 0.57
80 0.65
81 0.7
82 0.73
83 0.74
84 0.71
85 0.72
86 0.71
87 0.67
88 0.65
89 0.69
90 0.7
91 0.71
92 0.73
93 0.71
94 0.72
95 0.78
96 0.8
97 0.8
98 0.81
99 0.83
100 0.86
101 0.9
102 0.85
103 0.84
104 0.84