Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0CEY9

Protein Details
Accession Q0CEY9    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
89-108EEKINKIKWCRRQNASHFLLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, cyto 3.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000009  PP2A_PR55  
IPR018067  PP2A_PR55_CS  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
IPR001680  WD40_repeat  
IPR036322  WD40_repeat_dom_sf  
Gene Ontology GO:0005935  C:cellular bud neck  
GO:0005934  C:cellular bud tip  
GO:0000329  C:fungal-type vacuole membrane  
GO:0043332  C:mating projection tip  
GO:0072686  C:mitotic spindle  
GO:0005634  C:nucleus  
GO:0000159  C:protein phosphatase type 2A complex  
GO:0019888  F:protein phosphatase regulator activity  
GO:0045143  P:homologous chromosome segregation  
GO:0016237  P:lysosomal microautophagy  
GO:0044818  P:mitotic G2/M transition checkpoint  
GO:0001100  P:negative regulation of exit from mitosis  
GO:0010515  P:negative regulation of induction of conjugation with cellular fusion  
GO:0031030  P:negative regulation of septation initiation signaling  
GO:2000786  P:positive regulation of autophagosome assembly  
GO:0010971  P:positive regulation of G2/M transition of mitotic cell cycle  
GO:1905477  P:positive regulation of protein localization to membrane  
GO:1900182  P:positive regulation of protein localization to nucleus  
GO:0061586  P:positive regulation of transcription by transcription factor localization  
GO:0006470  P:protein dephosphorylation  
GO:0090266  P:regulation of mitotic cell cycle spindle assembly checkpoint  
Pfam View protein in Pfam  
PF00400  WD40  
PROSITE View protein in PROSITE  
PS01024  PR55_1  
PS01025  PR55_2  
Amino Acid Sequences MVDRDPGTPTWKFTQCFGDKGDVEDITEADIISTVEFDHTGNYLATGDKGGRVVLFERNETKKTCEYKFHTEFQSHEPEFDYLKSLEIEEKINKIKWCRRQNASHFLLSTNDKTIKLWKVFDKSLKVVAENNLSSELTPAGVGGGGAPRPPRLSFKDASALKLPRMTHHDTVVAAVPRRTYANAHAYHINSISVNSDGETFISSDDLRINLWNLNIQEQSFNIVDIKPANMEELTEVITAAEFHPTSCNWFMYASSKGTIKLADMRQRALCDEHHKLFEQEEDASSRSFFSEIISSISDVRFSHDGRYIVSRDYLTVKIWDVNMERQPVKTIPIHEHLRPRLCDTYENDSIFDKFEVVFSGDAENVMTGSYNNNFMIYPTDPSKETEIVLQADKSAFKAKKVGVPTPMNKGANGKKSGSRSTSPAGPGSRMKKETDADQIDFNKKILHMSWHPYEDSIAIAATNNVRDPLSSYLFYHANPGVALCFLRIVSTWEEGSSSYMDRCIEVHAGPHMTERKEVASSSICRSKNQVASSIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.46
3 0.47
4 0.46
5 0.46
6 0.4
7 0.42
8 0.43
9 0.33
10 0.3
11 0.27
12 0.24
13 0.17
14 0.17
15 0.13
16 0.09
17 0.09
18 0.08
19 0.07
20 0.07
21 0.06
22 0.06
23 0.07
24 0.07
25 0.08
26 0.08
27 0.1
28 0.1
29 0.1
30 0.1
31 0.1
32 0.11
33 0.11
34 0.11
35 0.11
36 0.12
37 0.12
38 0.11
39 0.12
40 0.14
41 0.19
42 0.21
43 0.24
44 0.31
45 0.36
46 0.39
47 0.4
48 0.43
49 0.45
50 0.49
51 0.5
52 0.52
53 0.54
54 0.61
55 0.64
56 0.65
57 0.62
58 0.58
59 0.57
60 0.53
61 0.56
62 0.45
63 0.41
64 0.36
65 0.32
66 0.31
67 0.28
68 0.26
69 0.16
70 0.17
71 0.17
72 0.16
73 0.17
74 0.17
75 0.21
76 0.2
77 0.25
78 0.28
79 0.32
80 0.35
81 0.41
82 0.48
83 0.54
84 0.62
85 0.66
86 0.69
87 0.75
88 0.8
89 0.81
90 0.77
91 0.71
92 0.61
93 0.53
94 0.49
95 0.42
96 0.36
97 0.31
98 0.29
99 0.25
100 0.25
101 0.31
102 0.35
103 0.34
104 0.37
105 0.38
106 0.42
107 0.47
108 0.52
109 0.51
110 0.46
111 0.49
112 0.45
113 0.4
114 0.37
115 0.35
116 0.35
117 0.29
118 0.27
119 0.23
120 0.22
121 0.21
122 0.18
123 0.14
124 0.09
125 0.08
126 0.07
127 0.05
128 0.05
129 0.05
130 0.04
131 0.06
132 0.06
133 0.08
134 0.09
135 0.1
136 0.12
137 0.14
138 0.19
139 0.23
140 0.29
141 0.29
142 0.32
143 0.4
144 0.38
145 0.4
146 0.42
147 0.37
148 0.32
149 0.35
150 0.32
151 0.27
152 0.33
153 0.36
154 0.31
155 0.31
156 0.31
157 0.27
158 0.28
159 0.28
160 0.24
161 0.2
162 0.18
163 0.17
164 0.16
165 0.17
166 0.17
167 0.15
168 0.18
169 0.25
170 0.26
171 0.28
172 0.31
173 0.3
174 0.31
175 0.29
176 0.24
177 0.15
178 0.14
179 0.13
180 0.09
181 0.09
182 0.07
183 0.08
184 0.07
185 0.07
186 0.08
187 0.07
188 0.06
189 0.07
190 0.07
191 0.07
192 0.07
193 0.07
194 0.07
195 0.08
196 0.09
197 0.09
198 0.09
199 0.12
200 0.11
201 0.13
202 0.14
203 0.13
204 0.13
205 0.11
206 0.14
207 0.12
208 0.11
209 0.1
210 0.09
211 0.1
212 0.1
213 0.1
214 0.07
215 0.07
216 0.08
217 0.07
218 0.07
219 0.06
220 0.06
221 0.07
222 0.07
223 0.06
224 0.05
225 0.05
226 0.06
227 0.06
228 0.07
229 0.06
230 0.06
231 0.07
232 0.07
233 0.11
234 0.12
235 0.12
236 0.11
237 0.11
238 0.12
239 0.13
240 0.16
241 0.13
242 0.13
243 0.13
244 0.13
245 0.13
246 0.13
247 0.11
248 0.15
249 0.18
250 0.24
251 0.24
252 0.26
253 0.27
254 0.27
255 0.27
256 0.23
257 0.21
258 0.2
259 0.24
260 0.24
261 0.24
262 0.24
263 0.24
264 0.22
265 0.21
266 0.16
267 0.12
268 0.11
269 0.11
270 0.11
271 0.11
272 0.1
273 0.09
274 0.08
275 0.08
276 0.07
277 0.06
278 0.07
279 0.07
280 0.09
281 0.09
282 0.09
283 0.1
284 0.1
285 0.1
286 0.09
287 0.11
288 0.12
289 0.12
290 0.14
291 0.17
292 0.18
293 0.18
294 0.21
295 0.2
296 0.18
297 0.19
298 0.17
299 0.14
300 0.16
301 0.16
302 0.13
303 0.13
304 0.13
305 0.14
306 0.14
307 0.16
308 0.14
309 0.18
310 0.21
311 0.24
312 0.24
313 0.22
314 0.25
315 0.22
316 0.24
317 0.22
318 0.22
319 0.22
320 0.28
321 0.32
322 0.33
323 0.4
324 0.42
325 0.45
326 0.44
327 0.44
328 0.41
329 0.39
330 0.4
331 0.36
332 0.38
333 0.38
334 0.37
335 0.34
336 0.3
337 0.29
338 0.26
339 0.21
340 0.14
341 0.09
342 0.08
343 0.09
344 0.09
345 0.08
346 0.08
347 0.09
348 0.08
349 0.08
350 0.08
351 0.07
352 0.05
353 0.05
354 0.05
355 0.04
356 0.06
357 0.07
358 0.09
359 0.09
360 0.1
361 0.1
362 0.1
363 0.13
364 0.13
365 0.15
366 0.16
367 0.18
368 0.18
369 0.2
370 0.23
371 0.2
372 0.2
373 0.19
374 0.19
375 0.19
376 0.2
377 0.18
378 0.15
379 0.15
380 0.15
381 0.14
382 0.2
383 0.19
384 0.19
385 0.25
386 0.26
387 0.31
388 0.36
389 0.39
390 0.39
391 0.46
392 0.48
393 0.5
394 0.55
395 0.5
396 0.45
397 0.48
398 0.47
399 0.47
400 0.48
401 0.43
402 0.41
403 0.46
404 0.51
405 0.49
406 0.45
407 0.41
408 0.41
409 0.44
410 0.4
411 0.4
412 0.36
413 0.34
414 0.39
415 0.41
416 0.45
417 0.42
418 0.42
419 0.42
420 0.42
421 0.43
422 0.46
423 0.45
424 0.38
425 0.42
426 0.45
427 0.44
428 0.42
429 0.38
430 0.31
431 0.25
432 0.27
433 0.23
434 0.25
435 0.26
436 0.32
437 0.37
438 0.38
439 0.38
440 0.36
441 0.35
442 0.27
443 0.23
444 0.17
445 0.11
446 0.08
447 0.08
448 0.09
449 0.1
450 0.11
451 0.11
452 0.12
453 0.12
454 0.12
455 0.15
456 0.18
457 0.21
458 0.21
459 0.22
460 0.25
461 0.26
462 0.26
463 0.28
464 0.23
465 0.2
466 0.18
467 0.18
468 0.14
469 0.14
470 0.14
471 0.09
472 0.09
473 0.08
474 0.09
475 0.09
476 0.12
477 0.14
478 0.17
479 0.17
480 0.16
481 0.17
482 0.16
483 0.18
484 0.17
485 0.15
486 0.13
487 0.15
488 0.15
489 0.15
490 0.16
491 0.17
492 0.18
493 0.16
494 0.18
495 0.2
496 0.22
497 0.22
498 0.28
499 0.31
500 0.3
501 0.32
502 0.31
503 0.3
504 0.3
505 0.3
506 0.28
507 0.29
508 0.31
509 0.36
510 0.43
511 0.41
512 0.41
513 0.47
514 0.51
515 0.51
516 0.51