Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0CLP6

Protein Details
Accession Q0CLP6    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
86-117KRLCDGCKPVRRKNRVYIICSKNPKHKQRQGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 7, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MLSLRSVLGSSTRALRHLPSASRPTTTTTTTSGFFFSRQYSSQLTKSLTNGLQRLRGAAQGNVASLGSSVRQIEQVRGMKTRSSVKRLCDGCKPVRRKNRVYIICSKNPKHKQRQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.25
4 0.29
5 0.31
6 0.33
7 0.38
8 0.39
9 0.39
10 0.39
11 0.38
12 0.36
13 0.35
14 0.3
15 0.26
16 0.26
17 0.25
18 0.25
19 0.22
20 0.19
21 0.17
22 0.16
23 0.15
24 0.16
25 0.16
26 0.18
27 0.2
28 0.23
29 0.25
30 0.26
31 0.26
32 0.25
33 0.25
34 0.26
35 0.24
36 0.24
37 0.24
38 0.22
39 0.24
40 0.22
41 0.22
42 0.19
43 0.2
44 0.17
45 0.15
46 0.15
47 0.12
48 0.12
49 0.11
50 0.1
51 0.07
52 0.06
53 0.06
54 0.04
55 0.05
56 0.05
57 0.05
58 0.09
59 0.1
60 0.11
61 0.19
62 0.23
63 0.24
64 0.27
65 0.27
66 0.25
67 0.28
68 0.36
69 0.35
70 0.38
71 0.4
72 0.41
73 0.49
74 0.52
75 0.52
76 0.51
77 0.53
78 0.55
79 0.6
80 0.65
81 0.66
82 0.73
83 0.78
84 0.77
85 0.79
86 0.81
87 0.79
88 0.78
89 0.78
90 0.76
91 0.77
92 0.79
93 0.75
94 0.75
95 0.77
96 0.81
97 0.82