Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0C7X6

Protein Details
Accession Q0C7X6   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
86-116LARLYERQKCGPRWRKKWLSRGAPQRRCIGSHydrophilic
NLS Segment(s)
PositionSequence
100-102RKK
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR017930  Myb_dom  
IPR001005  SANT/Myb  
Pfam View protein in Pfam  
PF00249  Myb_DNA-binding  
PROSITE View protein in PROSITE  
PS51294  HTH_MYB  
PS50090  MYB_LIKE  
CDD cd00167  SANT  
Amino Acid Sequences MPPAPPPVSVPAKRLQPAHTAESPAKKQSKWSPEEDALIIELRGSGMKWEDISKRLPGRSAISCRLHYQNYLERRSEWDEDKKNKLARLYERQKCGPRWRKKWLSRGAPQRRCIGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.44
3 0.42
4 0.44
5 0.47
6 0.43
7 0.41
8 0.41
9 0.46
10 0.46
11 0.46
12 0.46
13 0.4
14 0.44
15 0.49
16 0.54
17 0.51
18 0.53
19 0.52
20 0.5
21 0.52
22 0.44
23 0.36
24 0.27
25 0.23
26 0.17
27 0.1
28 0.08
29 0.06
30 0.05
31 0.05
32 0.04
33 0.05
34 0.06
35 0.06
36 0.1
37 0.11
38 0.13
39 0.15
40 0.19
41 0.22
42 0.22
43 0.22
44 0.21
45 0.23
46 0.26
47 0.29
48 0.31
49 0.32
50 0.33
51 0.34
52 0.36
53 0.33
54 0.3
55 0.29
56 0.3
57 0.33
58 0.36
59 0.34
60 0.31
61 0.35
62 0.38
63 0.37
64 0.35
65 0.38
66 0.43
67 0.48
68 0.53
69 0.55
70 0.54
71 0.53
72 0.52
73 0.5
74 0.5
75 0.55
76 0.6
77 0.6
78 0.63
79 0.68
80 0.71
81 0.71
82 0.74
83 0.74
84 0.74
85 0.76
86 0.8
87 0.84
88 0.86
89 0.88
90 0.88
91 0.87
92 0.86
93 0.88
94 0.89
95 0.87
96 0.82