Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0CVD9

Protein Details
Accession Q0CVD9   
Localization Confidence Low
Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
77-103ASPTPSPQKQRITKRKKVEEPTVKGEEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11, cyto_nucl 10.833, nucl 9.5, cyto_mito 8.833, mito 5.5
Family & Domain DBs
Amino Acid Sequences MAPPKNKTDANVMFLYICLMKSGKEIDFNAVAEATNLNPPAARMRYYRLKKVLDPQIIDGKADLTKAAAGEGDASEASPTPSPQKQRITKRKKVEEPTVKGEEEAQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.18
4 0.14
5 0.1
6 0.09
7 0.09
8 0.11
9 0.14
10 0.14
11 0.17
12 0.18
13 0.2
14 0.22
15 0.22
16 0.2
17 0.17
18 0.15
19 0.11
20 0.11
21 0.08
22 0.08
23 0.08
24 0.08
25 0.08
26 0.08
27 0.13
28 0.14
29 0.15
30 0.15
31 0.2
32 0.3
33 0.35
34 0.41
35 0.42
36 0.43
37 0.43
38 0.5
39 0.53
40 0.47
41 0.44
42 0.4
43 0.4
44 0.37
45 0.35
46 0.26
47 0.19
48 0.15
49 0.14
50 0.12
51 0.05
52 0.06
53 0.06
54 0.06
55 0.05
56 0.04
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.05
64 0.07
65 0.07
66 0.08
67 0.12
68 0.17
69 0.23
70 0.3
71 0.4
72 0.48
73 0.58
74 0.69
75 0.74
76 0.79
77 0.84
78 0.88
79 0.88
80 0.87
81 0.87
82 0.87
83 0.84
84 0.82
85 0.77
86 0.66
87 0.57
88 0.5