Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0CYE6

Protein Details
Accession Q0CYE6   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
193-214PDSYQWKKAKKGKRYDLELKGIHydrophilic
233-259HSLEVKNKNGNKRGSKRTRGPDESPSSHydrophilic
NLS Segment(s)
PositionSequence
202-203KK
244-248KRGSK
Subcellular Location(s) mito 16.5, cyto_mito 10.333, nucl 5.5, cyto_nucl 4.833, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019136  TF_IIIC_su-5_HTH  
IPR040454  TF_IIIC_Tfc1/Sfc1  
Gene Ontology GO:0000127  C:transcription factor TFIIIC complex  
GO:0006384  P:transcription initiation at RNA polymerase III promoter  
Pfam View protein in Pfam  
PF09734  Tau95  
Amino Acid Sequences MAPLVNEIRSFLLGRPIATLRVIHVSLGSYSIKEILRALPFCGYKFRDGPWEGALVQFGVDPRLKPFCRVYQTLTFKTSLNPIVYFESTSVPGLDTLEFPQFYPPTSRERHMFDGKMFDPTADTWQICDLCDPQLARIAATTDTKLLPTQDTGYFKVATMAKLTVIMYDKLICIRDQWPLHTENEYEVLLVLPDSYQWKKAKKGKRYDLELKGISTKWQQNLWGKMIRYLYEHSLEVKNKNGNKRGSKRTRGPDESPSSTGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.25
3 0.24
4 0.24
5 0.24
6 0.24
7 0.18
8 0.22
9 0.22
10 0.18
11 0.17
12 0.17
13 0.15
14 0.18
15 0.16
16 0.11
17 0.11
18 0.15
19 0.15
20 0.14
21 0.16
22 0.17
23 0.23
24 0.23
25 0.24
26 0.26
27 0.27
28 0.28
29 0.34
30 0.31
31 0.3
32 0.32
33 0.32
34 0.34
35 0.35
36 0.36
37 0.31
38 0.3
39 0.26
40 0.24
41 0.23
42 0.14
43 0.12
44 0.1
45 0.09
46 0.09
47 0.11
48 0.11
49 0.14
50 0.22
51 0.22
52 0.25
53 0.3
54 0.35
55 0.4
56 0.42
57 0.45
58 0.47
59 0.53
60 0.53
61 0.5
62 0.44
63 0.38
64 0.37
65 0.35
66 0.28
67 0.23
68 0.2
69 0.19
70 0.21
71 0.21
72 0.2
73 0.17
74 0.15
75 0.14
76 0.14
77 0.12
78 0.09
79 0.09
80 0.09
81 0.09
82 0.08
83 0.09
84 0.1
85 0.1
86 0.1
87 0.14
88 0.13
89 0.13
90 0.16
91 0.16
92 0.2
93 0.23
94 0.25
95 0.25
96 0.3
97 0.35
98 0.36
99 0.36
100 0.31
101 0.34
102 0.32
103 0.31
104 0.26
105 0.2
106 0.16
107 0.15
108 0.17
109 0.13
110 0.13
111 0.1
112 0.12
113 0.13
114 0.12
115 0.12
116 0.09
117 0.09
118 0.11
119 0.1
120 0.09
121 0.13
122 0.13
123 0.12
124 0.12
125 0.12
126 0.11
127 0.12
128 0.12
129 0.09
130 0.09
131 0.09
132 0.1
133 0.09
134 0.09
135 0.09
136 0.11
137 0.14
138 0.16
139 0.18
140 0.19
141 0.19
142 0.18
143 0.22
144 0.2
145 0.17
146 0.16
147 0.14
148 0.12
149 0.13
150 0.13
151 0.1
152 0.11
153 0.11
154 0.1
155 0.1
156 0.11
157 0.11
158 0.12
159 0.1
160 0.11
161 0.12
162 0.19
163 0.19
164 0.21
165 0.23
166 0.24
167 0.26
168 0.25
169 0.24
170 0.18
171 0.19
172 0.17
173 0.14
174 0.12
175 0.1
176 0.08
177 0.07
178 0.06
179 0.04
180 0.05
181 0.09
182 0.1
183 0.17
184 0.22
185 0.27
186 0.36
187 0.46
188 0.54
189 0.6
190 0.7
191 0.74
192 0.78
193 0.82
194 0.83
195 0.81
196 0.79
197 0.71
198 0.62
199 0.55
200 0.46
201 0.41
202 0.38
203 0.37
204 0.32
205 0.33
206 0.38
207 0.43
208 0.48
209 0.5
210 0.49
211 0.44
212 0.45
213 0.45
214 0.4
215 0.35
216 0.33
217 0.32
218 0.29
219 0.29
220 0.28
221 0.32
222 0.35
223 0.35
224 0.38
225 0.42
226 0.45
227 0.54
228 0.58
229 0.6
230 0.67
231 0.73
232 0.78
233 0.81
234 0.84
235 0.85
236 0.88
237 0.89
238 0.86
239 0.82
240 0.81
241 0.79
242 0.74