Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0CA18

Protein Details
Accession Q0CA18    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAPKKSKAKTKKPMLLSHTRPHydrophilic
NLS Segment(s)
PositionSequence
4-49KKSKAKTKKPMLLSHTRPPTVRPKAALSAKATRNLIRSHHRLLKKK
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021867  Bmt2/SAMTOR  
Gene Ontology GO:0005730  C:nucleolus  
GO:0016433  F:rRNA (adenine) methyltransferase activity  
Pfam View protein in Pfam  
PF11968  Bmt2  
Amino Acid Sequences MAPKKSKAKTKKPMLLSHTRPPTVRPKAALSAKATRNLIRSHHRLLKKKAQASQAGDEALVRKLDAQIQRNGGLESYQLASKIGQSLERGGDSSKVLVDWIGPQLAQLQANGLKLRVLEVGALSTKNACSMNESLDVTRIDLNSQEPGILKQDFMERPLPRGDHERFHILSLSLVLNYVPDALGRGEMLKRCVTFLTSSSPSGSSMSITPRLFLVLPLACVKNSRYLTESRLQDILQSLGFVLAESKETSKLIFQLWEYTGASSPKPFKKELLNDGKIRNNFAIVIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.8
4 0.79
5 0.77
6 0.71
7 0.63
8 0.6
9 0.63
10 0.61
11 0.59
12 0.53
13 0.5
14 0.55
15 0.61
16 0.61
17 0.57
18 0.56
19 0.55
20 0.58
21 0.55
22 0.49
23 0.47
24 0.45
25 0.46
26 0.45
27 0.47
28 0.5
29 0.56
30 0.61
31 0.66
32 0.72
33 0.75
34 0.76
35 0.76
36 0.74
37 0.72
38 0.72
39 0.68
40 0.63
41 0.55
42 0.46
43 0.39
44 0.34
45 0.28
46 0.22
47 0.16
48 0.11
49 0.1
50 0.1
51 0.17
52 0.22
53 0.25
54 0.28
55 0.31
56 0.33
57 0.33
58 0.32
59 0.26
60 0.2
61 0.16
62 0.13
63 0.11
64 0.09
65 0.09
66 0.09
67 0.09
68 0.09
69 0.12
70 0.11
71 0.11
72 0.12
73 0.14
74 0.15
75 0.15
76 0.15
77 0.12
78 0.13
79 0.12
80 0.12
81 0.1
82 0.08
83 0.08
84 0.07
85 0.07
86 0.07
87 0.08
88 0.07
89 0.07
90 0.07
91 0.09
92 0.1
93 0.1
94 0.08
95 0.09
96 0.1
97 0.12
98 0.13
99 0.11
100 0.1
101 0.1
102 0.11
103 0.09
104 0.08
105 0.06
106 0.06
107 0.07
108 0.07
109 0.07
110 0.06
111 0.06
112 0.06
113 0.08
114 0.08
115 0.07
116 0.1
117 0.11
118 0.13
119 0.15
120 0.15
121 0.14
122 0.15
123 0.15
124 0.13
125 0.13
126 0.11
127 0.09
128 0.09
129 0.1
130 0.08
131 0.08
132 0.08
133 0.07
134 0.08
135 0.1
136 0.1
137 0.09
138 0.09
139 0.14
140 0.14
141 0.16
142 0.22
143 0.19
144 0.21
145 0.24
146 0.24
147 0.2
148 0.27
149 0.27
150 0.24
151 0.26
152 0.29
153 0.27
154 0.27
155 0.27
156 0.2
157 0.17
158 0.15
159 0.13
160 0.08
161 0.07
162 0.07
163 0.06
164 0.05
165 0.05
166 0.04
167 0.03
168 0.04
169 0.05
170 0.05
171 0.05
172 0.07
173 0.09
174 0.11
175 0.14
176 0.15
177 0.15
178 0.16
179 0.16
180 0.16
181 0.15
182 0.15
183 0.19
184 0.19
185 0.2
186 0.2
187 0.2
188 0.2
189 0.19
190 0.18
191 0.12
192 0.12
193 0.15
194 0.2
195 0.19
196 0.19
197 0.18
198 0.19
199 0.18
200 0.16
201 0.17
202 0.11
203 0.13
204 0.16
205 0.17
206 0.15
207 0.17
208 0.18
209 0.22
210 0.23
211 0.24
212 0.23
213 0.26
214 0.31
215 0.37
216 0.38
217 0.33
218 0.33
219 0.3
220 0.29
221 0.28
222 0.24
223 0.16
224 0.14
225 0.11
226 0.1
227 0.1
228 0.08
229 0.07
230 0.06
231 0.07
232 0.09
233 0.1
234 0.11
235 0.12
236 0.13
237 0.14
238 0.15
239 0.16
240 0.17
241 0.17
242 0.21
243 0.22
244 0.24
245 0.23
246 0.23
247 0.24
248 0.23
249 0.24
250 0.24
251 0.31
252 0.35
253 0.38
254 0.39
255 0.4
256 0.48
257 0.55
258 0.6
259 0.63
260 0.64
261 0.65
262 0.7
263 0.74
264 0.66
265 0.62
266 0.52
267 0.43