Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q0CIF0

Protein Details
Accession Q0CIF0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
404-426ESGILRRSTRHWRRTLLRKLSLAHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 22, mito 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013057  AA_transpt_TM  
Gene Ontology GO:0000329  C:fungal-type vacuole membrane  
GO:0061459  F:L-arginine transmembrane transporter activity  
GO:0005313  F:L-glutamate transmembrane transporter activity  
GO:0005290  F:L-histidine transmembrane transporter activity  
GO:0015189  F:L-lysine transmembrane transporter activity  
GO:0015194  F:L-serine transmembrane transporter activity  
GO:0005302  F:L-tyrosine transmembrane transporter activity  
GO:0090518  P:L-arginine transmembrane import into vacuole  
GO:1901481  P:L-glutamate import involved in cellular response to nitrogen starvation  
GO:0090515  P:L-glutamate transmembrane import into vacuole  
GO:0090513  P:L-histidine transmembrane import into vacuole  
GO:1901482  P:L-lysine import into vacuole involved in cellular response to nitrogen starvation  
GO:0090516  P:L-serine transmembrane import into vacuole  
GO:0090514  P:L-tyrosine transmembrane import into vacuole  
Pfam View protein in Pfam  
PF01490  Aa_trans  
Amino Acid Sequences MPLAISHMGIVLGVIVILWSGVTAGFGLYLQSRCAQYLDRGTASFFALSQLTYPNAAVVFDAAIAIKCFGVGVSYLIIIGDLMPGVVQGFVGGSPVYDFLVDRHFWVTAFMLIVIPLSYLRRLDSLKYTSIAALVSMAYLVVLVVYHFVEGDTMADRGPIRVIHWAGPVPTLSSLPVIVFAFTCHQNMFSILNEIENNSHLRTTAVVFSSIGSAAATYILVAITGYLSFGNNVGGNIVGMYPPGLWATIGRAAIVILVMFSYPLQCHPCRASVDAVLRWRPKPSSAGNDNSPHRHPLLGPRGSRAPEMSDLRFSVITTTILVLSYIVAMTVSSLEAVLAYVGSTGSTSISFILPGLFYYKISSPDSPTHQRLMKEDDEAAEDMLADDSNDDDDNEASQSRPLTESGILRRSTRHWRRTLLRKLSLALSIYGVVVMIVCLVTNSLFIASH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.03
6 0.02
7 0.03
8 0.03
9 0.03
10 0.03
11 0.04
12 0.04
13 0.04
14 0.06
15 0.09
16 0.1
17 0.12
18 0.15
19 0.16
20 0.17
21 0.19
22 0.2
23 0.23
24 0.3
25 0.34
26 0.33
27 0.32
28 0.32
29 0.32
30 0.31
31 0.25
32 0.17
33 0.13
34 0.12
35 0.11
36 0.11
37 0.12
38 0.12
39 0.13
40 0.12
41 0.12
42 0.11
43 0.11
44 0.1
45 0.08
46 0.07
47 0.06
48 0.07
49 0.06
50 0.06
51 0.07
52 0.07
53 0.06
54 0.06
55 0.06
56 0.05
57 0.06
58 0.06
59 0.06
60 0.06
61 0.06
62 0.07
63 0.06
64 0.06
65 0.06
66 0.05
67 0.04
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.04
79 0.04
80 0.04
81 0.05
82 0.05
83 0.06
84 0.06
85 0.06
86 0.06
87 0.11
88 0.12
89 0.13
90 0.13
91 0.13
92 0.13
93 0.14
94 0.14
95 0.1
96 0.1
97 0.09
98 0.08
99 0.08
100 0.08
101 0.06
102 0.06
103 0.06
104 0.06
105 0.07
106 0.08
107 0.09
108 0.12
109 0.13
110 0.16
111 0.21
112 0.24
113 0.24
114 0.25
115 0.25
116 0.22
117 0.21
118 0.18
119 0.12
120 0.09
121 0.07
122 0.05
123 0.05
124 0.04
125 0.03
126 0.03
127 0.03
128 0.02
129 0.02
130 0.02
131 0.03
132 0.03
133 0.04
134 0.04
135 0.04
136 0.04
137 0.04
138 0.05
139 0.05
140 0.05
141 0.05
142 0.07
143 0.07
144 0.07
145 0.08
146 0.08
147 0.08
148 0.13
149 0.14
150 0.15
151 0.16
152 0.17
153 0.16
154 0.17
155 0.16
156 0.12
157 0.11
158 0.1
159 0.08
160 0.08
161 0.08
162 0.07
163 0.08
164 0.07
165 0.07
166 0.07
167 0.07
168 0.09
169 0.1
170 0.11
171 0.09
172 0.09
173 0.09
174 0.11
175 0.11
176 0.09
177 0.11
178 0.1
179 0.11
180 0.11
181 0.11
182 0.1
183 0.1
184 0.11
185 0.09
186 0.09
187 0.08
188 0.08
189 0.08
190 0.09
191 0.1
192 0.09
193 0.09
194 0.1
195 0.1
196 0.1
197 0.09
198 0.08
199 0.05
200 0.04
201 0.04
202 0.04
203 0.03
204 0.03
205 0.03
206 0.03
207 0.03
208 0.02
209 0.02
210 0.02
211 0.02
212 0.03
213 0.03
214 0.03
215 0.03
216 0.04
217 0.04
218 0.05
219 0.05
220 0.04
221 0.04
222 0.04
223 0.04
224 0.04
225 0.03
226 0.03
227 0.03
228 0.03
229 0.03
230 0.04
231 0.04
232 0.03
233 0.04
234 0.06
235 0.09
236 0.09
237 0.08
238 0.08
239 0.08
240 0.08
241 0.08
242 0.06
243 0.02
244 0.03
245 0.02
246 0.03
247 0.03
248 0.03
249 0.04
250 0.06
251 0.11
252 0.11
253 0.14
254 0.16
255 0.2
256 0.21
257 0.23
258 0.23
259 0.23
260 0.26
261 0.27
262 0.29
263 0.31
264 0.33
265 0.32
266 0.33
267 0.29
268 0.28
269 0.3
270 0.31
271 0.34
272 0.37
273 0.41
274 0.43
275 0.48
276 0.5
277 0.49
278 0.45
279 0.39
280 0.33
281 0.3
282 0.25
283 0.29
284 0.35
285 0.37
286 0.36
287 0.37
288 0.41
289 0.41
290 0.41
291 0.33
292 0.26
293 0.26
294 0.29
295 0.27
296 0.25
297 0.24
298 0.25
299 0.24
300 0.21
301 0.16
302 0.13
303 0.12
304 0.1
305 0.1
306 0.09
307 0.08
308 0.08
309 0.07
310 0.06
311 0.05
312 0.05
313 0.04
314 0.03
315 0.03
316 0.03
317 0.04
318 0.04
319 0.03
320 0.04
321 0.03
322 0.04
323 0.04
324 0.03
325 0.03
326 0.03
327 0.03
328 0.03
329 0.03
330 0.03
331 0.04
332 0.04
333 0.05
334 0.05
335 0.06
336 0.06
337 0.06
338 0.07
339 0.07
340 0.06
341 0.07
342 0.09
343 0.09
344 0.09
345 0.12
346 0.14
347 0.17
348 0.21
349 0.22
350 0.24
351 0.3
352 0.37
353 0.42
354 0.43
355 0.46
356 0.46
357 0.47
358 0.46
359 0.47
360 0.42
361 0.38
362 0.36
363 0.3
364 0.29
365 0.28
366 0.24
367 0.16
368 0.14
369 0.11
370 0.1
371 0.09
372 0.05
373 0.05
374 0.05
375 0.07
376 0.07
377 0.07
378 0.07
379 0.07
380 0.09
381 0.1
382 0.1
383 0.09
384 0.11
385 0.12
386 0.13
387 0.14
388 0.14
389 0.16
390 0.19
391 0.25
392 0.3
393 0.35
394 0.36
395 0.35
396 0.38
397 0.41
398 0.49
399 0.53
400 0.56
401 0.57
402 0.64
403 0.73
404 0.8
405 0.85
406 0.84
407 0.82
408 0.75
409 0.71
410 0.64
411 0.58
412 0.49
413 0.39
414 0.3
415 0.23
416 0.19
417 0.16
418 0.13
419 0.09
420 0.07
421 0.06
422 0.04
423 0.04
424 0.03
425 0.04
426 0.04
427 0.05
428 0.05
429 0.06