Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0UCS5

Protein Details
Accession Q0UCS5    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
59-78VKYRPPKPYRHPTLDKRLTKBasic
NLS Segment(s)
Subcellular Location(s) nucl 11, cyto_nucl 9.5, cyto 6, pero 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR022495  Bud32  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004674  F:protein serine/threonine kinase activity  
GO:0016310  P:phosphorylation  
KEGG pno:SNOG_10439  -  
Amino Acid Sequences MTEPTPVPPIEPPPAPDTSLPLHTPPPPFSAQNLAQITQGAEALVYKSTFLTPHTPCVVKYRPPKPYRHPTLDKRLTKARLLAEARSLVRCRKEGDEWSLQGDVYLIDFGLTTASIQDEDKAVDLYVLERAFAATHPAAEPLFQEVLRAYGESYGGARGEGLGCFATEEQEWNITILAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.3
4 0.29
5 0.27
6 0.29
7 0.28
8 0.26
9 0.27
10 0.29
11 0.33
12 0.31
13 0.32
14 0.31
15 0.3
16 0.3
17 0.35
18 0.32
19 0.37
20 0.37
21 0.33
22 0.3
23 0.29
24 0.27
25 0.2
26 0.18
27 0.09
28 0.07
29 0.06
30 0.06
31 0.07
32 0.07
33 0.06
34 0.07
35 0.08
36 0.08
37 0.1
38 0.17
39 0.17
40 0.22
41 0.25
42 0.25
43 0.25
44 0.32
45 0.34
46 0.35
47 0.43
48 0.47
49 0.53
50 0.58
51 0.65
52 0.67
53 0.74
54 0.74
55 0.74
56 0.75
57 0.73
58 0.78
59 0.8
60 0.74
61 0.68
62 0.66
63 0.6
64 0.53
65 0.49
66 0.4
67 0.37
68 0.36
69 0.32
70 0.27
71 0.26
72 0.26
73 0.24
74 0.23
75 0.19
76 0.19
77 0.2
78 0.2
79 0.2
80 0.23
81 0.24
82 0.28
83 0.3
84 0.28
85 0.29
86 0.27
87 0.24
88 0.2
89 0.16
90 0.11
91 0.06
92 0.06
93 0.03
94 0.03
95 0.03
96 0.03
97 0.03
98 0.03
99 0.03
100 0.03
101 0.04
102 0.04
103 0.05
104 0.05
105 0.06
106 0.06
107 0.07
108 0.07
109 0.07
110 0.06
111 0.06
112 0.06
113 0.09
114 0.09
115 0.08
116 0.08
117 0.08
118 0.08
119 0.08
120 0.12
121 0.09
122 0.1
123 0.1
124 0.12
125 0.11
126 0.11
127 0.12
128 0.11
129 0.12
130 0.11
131 0.11
132 0.1
133 0.12
134 0.12
135 0.12
136 0.09
137 0.08
138 0.09
139 0.09
140 0.09
141 0.09
142 0.09
143 0.09
144 0.08
145 0.08
146 0.09
147 0.08
148 0.09
149 0.08
150 0.07
151 0.09
152 0.09
153 0.1
154 0.1
155 0.12
156 0.12
157 0.14
158 0.15
159 0.14